[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55182.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   61->112 1auxA PDBj 3e-04 22.0 %
:HMM:PFM   7->19 PF08139 * LPAM_1 0.00044 53.8 13/26  
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55182.1 GT:GENE BAF55182.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2405726..2406247) GB:FROM 2405726 GB:TO 2406247 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55182.1 LENGTH 173 SQ:AASEQ MKLRTIPALLAVALLAGCSGESADSQAVSAEETMEVTTTSTPVFEAKEVSPITVPSGDIRVEDPGLNVEFIFRGTRYGTNGGSIIHIAVKNLNDVALPADAIDPPTLDIEDYNGNKTNIETLSGDDNIPLDLPLGAGATTNLQYAFNTSNGSLSNAEFQIGNVIYSGNLNSLA GT:EXON 1|1-173:0| TM:NTM 1 TM:REGION 4->23| RP:PDB:NREP 1 RP:PDB:REP 61->112|1auxA|3e-04|22.0|50/292| HM:PFM:NREP 1 HM:PFM:REP 7->19|PF08139|0.00044|53.8|13/26|LPAM_1| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- -----111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 50 STR:RPRED 28.9 SQ:SECSTR ############################################################EccTTccHHHHTTTcE##ETTTEEEEEEEEcGGGEEEEEcTTccEEEEEccc############################################################# DISOP:02AL 1-2,21-32,172-174| PSIPRED ccEEHHHHHHHHHHHHcccccccccccccHHHEEEEEEcccccccHHccccEEEccccccccccccEEEEEEEEccccccccEEEEEEEccccccccccccccccEEEEEcccccEEEEEEccccccccccccccccccEEEEEEEEccccccEEcEEEEEEEEEEccccccc //