[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55201.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:66 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   17->54 PF12511 * DUF3716 0.00034 19.4 36/59  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55201.1 GT:GENE BAF55201.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2426600..2426800 GB:FROM 2426600 GB:TO 2426800 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55201.1 LENGTH 66 SQ:AASEQ MLNSIGASWTAGPVPQHKCTHCTKCRRTKRPWSNILSCASNQVFTQHNHSHCLNTDNKSATDEESH GT:EXON 1|1-66:0| HM:PFM:NREP 1 HM:PFM:REP 17->54|PF12511|0.00034|19.4|36/59|DUF3716| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,54-67| PSIPRED cccccccccccccccccHHHHHHHHHcccccHHHHHHHHcccHHHHccccHHcccccccccccccc //