[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55218.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  29/915 : Eukaryota  0/199 : Viruses  2/175   --->[See Alignment]
d.159.1
:220 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->180 1xm7A PDBj 2e-07 30.0 %
:RPS:PDB   23->123 3c8gD PDBj 5e-08 6.6 %
:RPS:SCOP  29->205 1xm7A  d.159.1.8 * 5e-11 20.6 %
:HMM:SCOP  28->214 1xm7A_ d.159.1.8 * 4.7e-15 26.3 %
:HMM:PFM   32->180 PF00149 * Metallophos 4e-09 20.3 138/200  
:BLT:SWISS 25->198 VG66_BPMD2 7e-32 46.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55218.1 GT:GENE BAF55218.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2444043..2444705) GB:FROM 2444043 GB:TO 2444705 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55218.1 LENGTH 220 SQ:AASEQ MYYKQLDSLVFTDGESIAKARLASMTDMWFSSDLHLGHKFVASMRGFDDPDEHDEVILSNFENTIGADDVLWILGDLSSGAHRAEERALSLMAERLGGVVKHLVPGNHDSCHPMYRHAYKRQRRFLEVFDSVQAFQRMKWDDEDVYLSHFPRPGQDHPGMESRFDDLRLRVPLLIHGHLHSQFPMTGPGQVDVGVEAWGLKPAPRELVQLKLWESLSEKI GT:EXON 1|1-220:0| BL:SWS:NREP 1 BL:SWS:REP 25->198|VG66_BPMD2|7e-32|46.2|169/199| BL:PDB:NREP 1 BL:PDB:REP 28->180|1xm7A|2e-07|30.0|140/186| RP:PDB:NREP 1 RP:PDB:REP 23->123|3c8gD|5e-08|6.6|91/153| HM:PFM:NREP 1 HM:PFM:REP 32->180|PF00149|4e-09|20.3|138/200|Metallophos| RP:SCP:NREP 1 RP:SCP:REP 29->205|1xm7A|5e-11|20.6|170/186|d.159.1.8| HM:SCP:REP 28->214|1xm7A_|4.7e-15|26.3|175/0|d.159.1.8|1/1|Metallo-dependent phosphatases| OP:NHOMO 33 OP:NHOMOORG 31 OP:PATTERN -------------------------------------------------------------------- ---1---11111-1--1--------1------------1--------------1-----------------1----12---1-------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------11--1--2--------111---11---------1-------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------1-----------------------------------------1------------------------------------ STR:NPRED 158 STR:RPRED 71.8 SQ:SECSTR ######################ccccHHHHHHHHHHcccHccccHHHHHHHHHHHHHHTTHHHHHHGGGGcccccHHHHHHTHHHHcTTcTTccHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHTTTTcccccEEEEcTTccEEEcccccEccccHHHHHHHHHHHHHccEEEEcccc######################################## DISOP:02AL 1-1,219-221| PSIPRED ccHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEcHHHcccccccHHHHHHHHHcccccEEEEEEcccccHHHHHHcHHHccHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccHHHHcccHHccccEEEEcccccccccccccEEEEEEEEcccccccHHHHHHHHHHHHHHcc //