[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55223.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:128 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   30->55 PF05952 * ComX 0.00019 26.9 26/57  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55223.1 GT:GENE BAF55223.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2450535..2450921 GB:FROM 2450535 GB:TO 2450921 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55223.1 LENGTH 128 SQ:AASEQ MPPSFFSRRRKNEPDLLALPAQVRDIRAKVLDIFMAESLVIINIDEKSAELLIDAARHHIPTRFTGPNARPLSVIPIEDPRSRPTLHPDHGWMMPLSPPVVDELLGGGLKIGETELESINIAFIVDAS GT:EXON 1|1-128:0| HM:PFM:NREP 1 HM:PFM:REP 30->55|PF05952|0.00019|26.9|26/57|ComX| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,6-7| PSIPRED cccccccHHHcccccEEEccHHHHHHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHcccccEEcccccccEEEEEcccccccccccccccEEcccccHHHHHHHccccccccEEEcccEEEEEEEcc //