[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55227.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  907/915 : Eukaryota  178/199 : Viruses  0/175   --->[See Alignment]
a.71.1
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->64 3cb4D PDBj 7e-19 56.2 %
:RPS:PDB   3->64 3cb4D PDBj 2e-20 56.5 %
:RPS:SCOP  2->99 1g7dA  a.71.1.1 * 5e-13 17.4 %
:RPS:PFM   1->104 PF06421 * LepA_C 1e-34 75.0 %
:HMM:PFM   2->103 PF06421 * LepA_C 3.4e-53 71.6 102/109  
:BLT:SWISS 1->106 LEPA_CORGL 4e-56 99.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55227.1 GT:GENE BAF55227.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2454256..2454576) GB:FROM 2454256 GB:TO 2454576 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55227.1 LENGTH 106 SQ:AASEQ MDAFSAIVHRDNAQWYGNKMTVKLKELIPRQQFEVPVQAAIGSKVIARENIRALRKDVLAKCYGGDISRKRKLLEKQKAGKKRMKNIGSVEVPQEAFVAALSTDEA GT:EXON 1|1-106:0| BL:SWS:NREP 1 BL:SWS:REP 1->106|LEPA_CORGL|4e-56|99.1|106/615| BL:PDB:NREP 1 BL:PDB:REP 1->64|3cb4D|7e-19|56.2|64/525| RP:PDB:NREP 1 RP:PDB:REP 3->64|3cb4D|2e-20|56.5|62/525| RP:PFM:NREP 1 RP:PFM:REP 1->104|PF06421|1e-34|75.0|104/109|LepA_C| HM:PFM:NREP 1 HM:PFM:REP 2->103|PF06421|3.4e-53|71.6|102/109|LepA_C| RP:SCP:NREP 1 RP:SCP:REP 2->99|1g7dA|5e-13|17.4|92/106|a.71.1.1| OP:NHOMO 1169 OP:NHOMOORG 1085 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111-1111111111111111111111111111-1111111111111111111111121111111111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 11--111-311-1111-11111111111111111111111111111-111111111111111111111111-111-1-1111111111-111-111111111111--13123211131-1-11123111161-112111-2-11111111111311111131-3111111A11111222Q222222112-23212111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 97.2 SQ:SECSTR EEEEEEEEEGGGHHHHHHHHHHHHHHHcccccccEEEEEEETTEEEEEEEEccccTTcccccccHHHTTTcEEEEEEEcTTcccEEEHEEEEEGGGccccccc### DISOP:02AL 75-83,105-107| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHcccHHHEEEccEEEEEccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccEEccHHHHHHHHHcccc //