[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55232.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  120/915 : Eukaryota  95/199 : Viruses  0/175   --->[See Alignment]
d.211.1
:151 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   30->125 1svxA PDBj 2e-13 41.9 %
:RPS:PDB   39->144 1e6yB PDBj 3e-19 6.8 %
:RPS:SCOP  54->146 1n11A  d.211.1.1 * 2e-18 26.9 %
:HMM:SCOP  54->150 1ot8A_ d.211.1.1 * 7.9e-20 36.1 %
:HMM:PFM   66->98 PF00023 * Ank 4.4e-14 42.4 33/33  
:HMM:PFM   101->129 PF00023 * Ank 0.00017 37.9 29/33  
:BLT:SWISS 19->147 Y3287_PSEAE 2e-21 46.8 %
:REPEAT 2|54->86|87->119

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55232.1 GT:GENE BAF55232.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2458189..2458644) GB:FROM 2458189 GB:TO 2458644 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55232.1 LENGTH 151 SQ:AASEQ MQSWRGVNAERWRVRYLSMTQSDLPDDVQELVTKIFGLARDGGAESAATLGAYVDNGVDVNLSNQDGNTLLMLAAYSGHADVVQALIERGADVDRVNNRNQTPLAGAIFKKEEAVIEALLAGGADPYAGTPTAVDTAKMFGREDLVARFES GT:EXON 1|1-151:0| BL:SWS:NREP 1 BL:SWS:REP 19->147|Y3287_PSEAE|2e-21|46.8|126/171| NREPEAT 1 REPEAT 2|54->86|87->119| BL:PDB:NREP 1 BL:PDB:REP 30->125|1svxA|2e-13|41.9|93/157| RP:PDB:NREP 1 RP:PDB:REP 39->144|1e6yB|3e-19|6.8|103/432| HM:PFM:NREP 2 HM:PFM:REP 66->98|PF00023|4.4e-14|42.4|33/33|Ank| HM:PFM:REP 101->129|PF00023|0.00017|37.9|29/33|Ank| RP:SCP:NREP 1 RP:SCP:REP 54->146|1n11A|2e-18|26.9|93/404|d.211.1.1| HM:SCP:REP 54->150|1ot8A_|7.9e-20|36.1|97/0|d.211.1.1|1/1|Ankyrin repeat| OP:NHOMO 570 OP:NHOMOORG 217 OP:PATTERN -------------2--1--------------------------------------------------- --1--111111---1----------------------111----2-11----11111--------2-1211--------------3----------3-----------1--------------------------------------111------------------11-------------1-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------2---------------------11111111-------------------------------11111111-111-----------------------------1--5------------------------11--------1---1-------111--------1------------------12--1--------------11-1-1--------1--1-111111-1-------------------------------1----------------------------1--------------------------------------------------------------------------------------------1-11----------------------------22221112-11112222--------------1111111------2-22111--1----1--1111------------------------------------------------- ---------------111-243-3-13-------------------1111111413-2-------------------------------15111-1----11------2--3533344355344CD1A2QjB2A7D3233A455235444A22I5A565264-4--221281-1-----2--------12-----1561 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 138 STR:RPRED 91.4 SQ:SECSTR #############HHHHHHTTccTTccccccccHHHHHTccGGGHHHHHHHHHHHHTTTTTccccTTccEEcccccGGGcccTTcGGGcccHHHHHHHTTTcHHHHHHHHHHHHHHHHHHTTcccTHHHHHHHHHHHHHccTTHHHHHHHT PSIPRED cHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHHHccccccccccccccHHHHHHHccHHHHHHHHHHccccccccccccccHHHHHHHHcHHHHHHHHHHcccccccccccHHHHHHHcccHHHHHHHHc //