[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55235.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  277/915 : Eukaryota  35/199 : Viruses  0/175   --->[See Alignment]
a.60.16a.60.2
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   136->194 2oceA PDBj 2e-07 35.6 %
:RPS:PDB   114->163 2bhnC PDBj 3e-04 20.0 %
:RPS:PDB   135->190 2eduA PDBj 2e-13 42.9 %
:RPS:SCOP  100->195 3ci0K2  a.60.16.1 * 2e-18 16.7 %
:HMM:SCOP  126->195 2a1jB1 a.60.2.5 * 4.8e-08 28.6 %
:RPS:PFM   136->185 PF03934 * GspK 2e-05 47.9 %
:HMM:PFM   136->163 PF00633 * HHH 7.9e-12 46.4 28/30  
:HMM:PFM   172->190 PF00633 * HHH 8.4e-06 42.1 19/30  
:HMM:PFM   61->114 PF10531 * SLBB 3.7e-13 35.2 54/59  
:BLT:SWISS 66->195 COMEA_BACSU 4e-19 38.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55235.1 GT:GENE BAF55235.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2461285..2461875) GB:FROM 2461285 GB:TO 2461875 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55235.1 LENGTH 196 SQ:AASEQ MRVNYPTPRFQISIKHGLIVCIILVVAFVGWFFTREKPVNPPTMAALAETYQTPAPSSQVVVSVVGHVAKPGLVTLAEGSRVADALAIAGTLPDADLTALNLAQLLVDGTQIHVLAIGEVQPISVDAAATSASGLISLNTATVADLVTLPGVGEKTAQAIIDFRESNGGFSTVEDLLQVKGIGPSKFEQISGLVSP GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 66->195|COMEA_BACSU|4e-19|38.5|130/205| TM:NTM 2 TM:REGION 12->34| TM:REGION 44->66| SEG 57->65|ssqvvvsvv| BL:PDB:NREP 1 BL:PDB:REP 136->194|2oceA|2e-07|35.6|59/729| RP:PDB:NREP 2 RP:PDB:REP 114->163|2bhnC|3e-04|20.0|50/194| RP:PDB:REP 135->190|2eduA|2e-13|42.9|56/98| RP:PFM:NREP 1 RP:PFM:REP 136->185|PF03934|2e-05|47.9|48/268|GspK| HM:PFM:NREP 3 HM:PFM:REP 136->163|PF00633|7.9e-12|46.4|28/30|HHH| HM:PFM:REP 172->190|PF00633|8.4e-06|42.1|19/30|HHH| HM:PFM:REP 61->114|PF10531|3.7e-13|35.2|54/59|SLBB| GO:PFM:NREP 2 GO:PFM GO:0009306|"GO:protein secretion"|PF03934|IPR005628| GO:PFM GO:0016021|"GO:integral to membrane"|PF03934|IPR005628| RP:SCP:NREP 1 RP:SCP:REP 100->195|3ci0K2|2e-18|16.7|96/110|a.60.16.1| HM:SCP:REP 126->195|2a1jB1|4.8e-08|28.6|70/0|a.60.2.5|1/1|RuvA domain 2-like| OP:NHOMO 319 OP:NHOMOORG 312 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11--111111111111111-1---1-1-111-1---1111111-1111111----11111111-----------------------------------------------------11111---11----11-1----------------------------------11--1111111111111111111111111111-11111111111-1--1-11111---11111-111-1-1111111111111-111-111111111111111111111111111111111-11111111111111111111111111111111111111111-1111111111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------211------------------1--------------1-----------------1----------------------11111----1-------------1--1-11--3----------------------------------------------------1-1----------------------------------------------------1------------------111111-----1------1--------------------------------11----------------------------------1-------------------------11-1111111--- ---------------------------------------------------------------------------------------------------------------1-111-----11-11-111311111-1113111--1-11111-1111-----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 65.8 SQ:SECSTR ###################################################################EccccTTTTTTTccTTcEEEcTTcHHHHHHHHHHTTccccHHHHHHHTTcccccGGHHHHHTTcccTHHHHHHccHHHHHHcTTccHHHHHHHHHHHHHHcccccGGGGGGcTTccHHHHHHHHHHGGc DISOP:02AL 1-2,39-59,116-130| PSIPRED ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEcccccEEEEccccccEEEEEEEcccccccEEEEcccccHHHHHHHccccccccHHHHcHHHHHHHHHHHHHccccccccccccccccccccEEEcccccHHHHHHcccccHHHHHHHHHHHHHHcccccHHHHHHcccccHHHHHHHHccccc //