[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55249.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:132 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55249.1 GT:GENE BAF55249.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2475586..2475984 GB:FROM 2475586 GB:TO 2475984 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55249.1 LENGTH 132 SQ:AASEQ MLYITQSPQKNPKNKKLPLTFPKGKQGAVLNSLSECDLSVNSLGLDDVHQATVALGGELDSASLQCEESVVATATNILTWVELGAALTNKDLACGNLLTTETLDAKALSLGITTVAGARCTLLVCHVVIPSF GT:EXON 1|1-132:0| SEG 10->19|knpknkklpl| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 4-18| PSIPRED cEEEccccccccccccccEEccccccccHHccHHHcccEEccccHHHHHHHHHHHccccccccEEEHHHHHHHHHHHHHHHHHHHHHccccccccccEEccccccEEEEEEEEEEcccEEEEEEEEEEEccc //