[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55258.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  37/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:114 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   28->97 2atrA PDBj 4e-05 14.3 %
:RPS:SCOP  13->94 1r57A  d.108.1.1 * 5e-16 22.5 %
:HMM:SCOP  10->94 1xmtA_ d.108.1.1 * 7.4e-17 38.8 %
:HMM:PFM   28->81 PF00583 * Acetyltransf_1 6e-06 27.8 54/83  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55258.1 GT:GENE BAF55258.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2483048..2483392 GB:FROM 2483048 GB:TO 2483392 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55258.1 LENGTH 114 SQ:AASEQ MTLKDKYDTEVAVSNNQDKHQFEVSYPEDAVTAGFAAYLDKGDSRIFYHTVVGDEFGGKGLASILVSEALKATKEAGLTVVPVCPFVKGFVEKNAFEGYRKPNHEDMELVKSQM GT:EXON 1|1-114:0| RP:PDB:NREP 1 RP:PDB:REP 28->97|2atrA|4e-05|14.3|70/127| HM:PFM:NREP 1 HM:PFM:REP 28->81|PF00583|6e-06|27.8|54/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 13->94|1r57A|5e-16|22.5|80/102|d.108.1.1| HM:SCP:REP 10->94|1xmtA_|7.4e-17|38.8|80/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 46 OP:NHOMOORG 37 OP:PATTERN -------------------------------------------------------------------- ----1-12222111111----2--12-----121112121-1---1-------11-1---------1-1-1-----------------------------------------------------------------------------------------------------------------11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111-------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 103 STR:RPRED 90.4 SQ:SECSTR ######HHHHccTTccTTccEEEEEEEETTEEEEEEEEEEccccEEEEEEEEcTTcccccHHHHHHHHHGGGTTccEEEccccccHHHHHHHHHTccccTTccEEEEEE##### DISOP:02AL 1-8| PSIPRED cccEEccccEEEEEEEccccEEEEEEcccccEEEEEEEEEcccEEEEEEEEEcHHHccccHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHccccccccccHHHHHHHHHcc //