[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55263.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  583/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:525 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   38->511 1b52A PDBj 2e-29 27.5 %
:RPS:PDB   21->513 1b52A PDBj 1e-72 22.1 %
:RPS:SCOP  21->513 1b05A  c.94.1.1 * 2e-72 23.0 %
:HMM:SCOP  26->523 1jetA_ c.94.1.1 * 9.3e-93 26.6 %
:RPS:PFM   79->444 PF00496 * SBP_bac_5 8e-26 30.0 %
:HMM:PFM   77->444 PF00496 * SBP_bac_5 3.8e-57 25.2 349/372  
:BLT:SWISS 40->495 OPPA_BACSU 1e-34 26.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55263.1 GT:GENE BAF55263.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2488640..2490217) GB:FROM 2488640 GB:TO 2490217 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55263.1 LENGTH 525 SQ:AASEQ MRTATKVIATVMASTLAIGLASCSSSSGTPDVNYVSVNGTEPQRGLIPGDTNENGGGRVVDMLYSGLVYFDEAGVAQNDLAESIDQESDTTYKITLRDGIKFSDGSDITATDFVDTWNFVVENGLLNTSFFSPIKGYEEGVETLEGLNVVDDRTFTIELVQPDSEFTQRIGYYGFAPMPASARDDIDAFGENPVSSGPYKLEQWDHNAELKVVANEHYDGPRAANNDGLKYVFYAQNDAAYSDLLAGNLDVLDLIPPSAYTTYEEELSGRSINQPAASYLELSIRMESPNFEGQQGQLRRQAISMAINREEIAEQIFAGTYTPALDFTAPVLDGWRDDLNGNDVLTFQPDKARELWEDAEEIAPFEGELQISYNADVPNREWVDAVANSISNELDVNATGNPFPDFKSFRDTYRTTGLDGAYRTAWFADYPSIGNFLGPNYTSGVASNDAKYENPEFDQLIADAAAASTKEETFQAYAQAQEMLLRDLPAIPLWYPNVVGGYSESVDNVSVNWKAIPVYWAITKQ GT:EXON 1|1-525:0| BL:SWS:NREP 1 BL:SWS:REP 40->495|OPPA_BACSU|1e-34|26.3|441/545| BL:PDB:NREP 1 BL:PDB:REP 38->511|1b52A|2e-29|27.5|459/515| RP:PDB:NREP 1 RP:PDB:REP 21->513|1b52A|1e-72|22.1|485/515| RP:PFM:NREP 1 RP:PFM:REP 79->444|PF00496|8e-26|30.0|353/366|SBP_bac_5| HM:PFM:NREP 1 HM:PFM:REP 77->444|PF00496|3.8e-57|25.2|349/372|SBP_bac_5| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF00496|IPR000914| GO:PFM GO:0006810|"GO:transport"|PF00496|IPR000914| RP:SCP:NREP 1 RP:SCP:REP 21->513|1b05A|2e-72|23.0|487/517|c.94.1.1| HM:SCP:REP 26->523|1jetA_|9.3e-93|26.6|492/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 2023 OP:NHOMOORG 607 OP:PATTERN 11--------------1-------21121-2112-----------3-2--874-2111------1--- 11--3442555-2121111-11--151111113---1824-5-B5644113137431222451154666714222644313-3-----------------------1--1-11111111-222211--------111111122185-1--11-11--1--------12--2------------6221122-323ABCBD9CB8ADDAADB75542BCA1139763333335O5111111111111111111-1A53-23---2-22--332222233322221111-11------------------------2-1112111217232222221222312221111211329-1-187-211-71-2371-45111---------11326--111---4434444344E-11511112CE--OBBD564A96ED61-11145636624322222222-2221-52-----------------------------------36653222222-222222642222-22253122--213--311--713412--2-22---------------14--1-21132221111111211-----21-11-1-1111111-1------1--11--651-12----1-------1-----11--1---111--------69C95666665654546-6665655565656566665888996655545555555555556844544453-544454444555---------------633333-11133324133--------14131111121422111-6471-11-11--132232222246533--1--------------D------555252123----------------------------111-2522214- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 511 STR:RPRED 97.3 SQ:SECSTR ##############EETTEEccccTTcccccccEEEEEcccccccccGGGcccHHHHHHHHHHccccEEEcTTccEEEccEEEEEEETTTEEEEEEcTTcccTTcccccHHHHHHHHHHHHcGGGTTHHHHHTcTTHHHHHGGGccEEEEETTEEEEEcccccTTGGGGGGcGGGccccHHHHHHHGTcTTTccccccEEEEEEETTTEEEEEEcTTcTTGGGccccEEEEEccccHHHHHHHHHTTccccccccccTTHHHHHHHcTTTEEEEEEEEEEEEEEcTTcTTTTcHHcHHHHHHHHHHccHHHHHHTTTccccEEccccccTTcTTccccccHHccHHHHHHHHHHHHHHTTcTcccccEEEEEEEccHHHHHHHHHHHHHHHHHHccEEEEEEEcHHHHHHHHHHHHTcccEEEEEEEcccccTHHHHGGGGcTTcTTcTTccccHHHHHHHHGGGccccHHHHHHHHHHHHHHHHHTTcEEEEEEEEEEEEccTTEEccccccTTcccGGGcccc DISOP:02AL 1-2,23-33| PSIPRED ccHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccccccccEEcccHHHHHHHHHHHHHEEEcccccEEEEEEEEEEEccccEEEEEEccccEEcccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccEEEccccEEEEEEccccHHHHHHHccccEEEccHHHHcccHHHcccccccccEEEEEEEcccEEEEEEcccccccccccEEEEEEEEEccHHHHHHHHHcccccEEccccHHHHHHHHcccccEEEEccccEEEEEEEEcccccccccccHHHHHHHHHHccHHHHHHHHHccccEEEccccccccccccccccccccccccHHHHHHHHHHccccccccEEEEEEEcccccHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccEEEEEEccEEEEEEcccccEEEccccccHHHcEEcc //