[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55276.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  384/915 : Eukaryota  149/199 : Viruses  0/175   --->[See Alignment]
c.124.1
:250 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->250 1o9lC PDBj 8e-64 50.0 %
:RPS:PDB   5->248 3cdkC PDBj 3e-50 57.1 %
:RPS:SCOP  4->236 1k6dA  c.124.1.2 * 5e-40 37.7 %
:HMM:SCOP  5->252 1m3eA1 c.124.1.2 * 1.6e-79 49.8 %
:RPS:PFM   11->234 PF01144 * CoA_trans 1e-28 42.9 %
:HMM:PFM   11->235 PF01144 * CoA_trans 8.7e-72 51.9 206/218  
:BLT:SWISS 21->248 SCOA_MYCTU 7e-73 59.2 %
:PROS 21->36|PS01273|COA_TRANSF_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55276.1 GT:GENE BAF55276.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2502847..2503599) GB:FROM 2502847 GB:TO 2503599 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55276.1 LENGTH 250 SQ:AASEQ MSHMINKSISSTAEAVADIPDGASIAVGGFGLVGIPTALILALREQGAGDLTIISNNLGTDGFGLGLLLLDKKISKSIGSYLGSNKEYARQYLEGELTVEFTPQGTLAERLRAGGAGIPAFYTTAGVGTQVAEGGLPQRYNTDGTVAVVSQPKETREFNGQLYVMEEGIRADYALVHAHKADRFGNLVFRKTAQNFNPDAAMSGKITIAQVEHFVDELHPDEIDLPGIYVNRVVHVGPQETGIENRTVSN GT:EXON 1|1-250:0| BL:SWS:NREP 1 BL:SWS:REP 21->248|SCOA_MYCTU|7e-73|59.2|228/248| PROS 21->36|PS01273|COA_TRANSF_1|PDOC00980| SEG 58->70|lgtdgfglgllll| BL:PDB:NREP 1 BL:PDB:REP 7->250|1o9lC|8e-64|50.0|244/425| RP:PDB:NREP 1 RP:PDB:REP 5->248|3cdkC|3e-50|57.1|226/229| RP:PFM:NREP 1 RP:PFM:REP 11->234|PF01144|1e-28|42.9|203/213|CoA_trans| HM:PFM:NREP 1 HM:PFM:REP 11->235|PF01144|8.7e-72|51.9|206/218|CoA_trans| GO:PFM:NREP 2 GO:PFM GO:0008152|"GO:metabolic process"|PF01144|IPR004165| GO:PFM GO:0008410|"GO:CoA-transferase activity"|PF01144|IPR004165| RP:SCP:NREP 1 RP:SCP:REP 4->236|1k6dA|5e-40|37.7|212/217|c.124.1.2| HM:SCP:REP 5->252|1m3eA1|1.6e-79|49.8|247/250|c.124.1.2|1/1|NagB/RpiA/CoA transferase-like| OP:NHOMO 852 OP:NHOMOORG 541 OP:PATTERN --------111111-----------11----------------------------------------- 11--5--31111---1111-12--111111113223-332-211-1-1----343211----2--2-111------------------------11---1-11111---1-----------------------------------1-------------------------------------322-----1-2111111111111111121112111---111------13--------------------1-----------------------------1111--------------2222222222222---------1-11151111111212-1--1-----------------2--3----1--2----2221-----222112111511111-211111-1-22222323----111311-2111-121112121111111--------2-----12------------11111111--11------1271-2442822222222222222222222222333331333231222222223111----------------1-21------------------1-1--111111-1-----------1-1111111----------1--2-13-2111111222211111121-------------1-1-1--1--111-111--11-11111--111111122221111-----------------2------1-----------------1-----------1-1-------11-1--1-45534241212-11111111222321111------------------------1111111111--------------------------------------------------11111-1------ ----111-531-----234333223331111111111111111111-2222434131222221-1----1----1------11111---13221111111111----121222124-1222121311212B2-115113111152111111111141121311311121121121--1----------13--112221- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 250 STR:RPRED 100.0 SQ:SECSTR ccTTcccccccHHHHHTTccTTcEEEEcccTTcTccHHHHHHHHHHTcccEEEEccccccTTcTTHHHHHTTcEEEEEEccccccHHHHHHHHHTccEEEEccHHHHHHHHHHHHHTccEEEEcTTTTcGGGTTccEEEETccccEEEEcccccEEEETTEEEEEEEcccEEEEEEEEEEEETTccEEccGGGcTTHHHHHHHEEEEEEEEEEEEccccTTTccccGGGccEEEEccccccccccccccc DISOP:02AL 1-5,244-244,248-251| PSIPRED cccccccccccHHHHHHHcccccEEEEccccccccHHHHHHHHHHHccccEEEEccccccccHHHHHHHHcccEEEEEEccccccHHHHHHHHcccEEEEEccHHHHHHHHHHHHccccEEEEEEEccccccccccccccccccccHHccccccEEEEccEEEEEEccccccEEEEEEEEcccccEEEEEcccccccHHHHHHccEEEEEEEEEEcccccccEEEcHHEEEEEEEcccccccEEEEcccc //