[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55307.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  11/68 : Bacteria  215/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.45.1
:392 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   14->162 2d38A PDBj 1e-13 27.9 %
:BLT:PDB   245->279 1hn0A PDBj 3e-04 42.4 %
:RPS:PDB   16->165 2d36A PDBj 5e-34 27.7 %
:RPS:SCOP  12->162 1wgbA  b.45.1.2 * 6e-41 24.8 %
:HMM:SCOP  8->173 1uscA_ b.45.1.2 * 1.3e-41 34.8 %
:RPS:PFM   24->160 PF01613 * Flavin_Reduct 2e-15 35.8 %
:HMM:PFM   20->163 PF01613 * Flavin_Reduct 4e-29 33.3 144/155  
:HMM:PFM   185->226 PF11220 * DUF3015 0.00025 33.3 42/144  
:BLT:SWISS 12->201 NTAB_CHEHE 1e-21 35.1 %
:BLT:SWISS 245->279 CABC_PROVU 9e-04 42.4 %
:BLT:SWISS 257->337 CASC1_MACFA 7e-04 24.7 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55307.1 GT:GENE BAF55307.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2536771..2537949 GB:FROM 2536771 GB:TO 2537949 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55307.1 LENGTH 392 SQ:AASEQ MSTNTVVSQKFDPKMFRNVMGHYPTGVAVVTGRASDGDLLALVVGTFSSVSLDPPLVSFMPMKSSKTFARMRECSSLCINIVGGEQEEEMLRIARRWENKLDGVDWYMSPSGDPILKNAVAWIDTSISSNIEAGDHWITLCEVHDMEVTNPVSPLLFFQGGYGSFVGTSLIARLSHEILPAIHSAHSAGDALENLATSIGCEVSVFAAVSEDEFATVFHSLSSNASEEQSFASRLPIVPPIGDTYMFDKPAEVQDRWFRKLNDPSEEILETHRMRLSLVEENKYLIAHLPEEGSVAYEQMVQASNEYKKARLTPAEERAIRQMIGSTTVDYNQRELVDSGSYQVGSIVFPVKDPNGEFTMTLRIGQLPQNVSGSTVAEWIALCKNVVEEIEN GT:EXON 1|1-392:0| BL:SWS:NREP 3 BL:SWS:REP 12->201|NTAB_CHEHE|1e-21|35.1|188/322| BL:SWS:REP 245->279|CABC_PROVU|9e-04|42.4|33/100| BL:SWS:REP 257->337|CASC1_MACFA|7e-04|24.7|81/722| BL:PDB:NREP 2 BL:PDB:REP 14->162|2d38A|1e-13|27.9|147/156| BL:PDB:REP 245->279|1hn0A|3e-04|42.4|33/971| RP:PDB:NREP 1 RP:PDB:REP 16->165|2d36A|5e-34|27.7|148/154| RP:PFM:NREP 1 RP:PFM:REP 24->160|PF01613|2e-15|35.8|137/150|Flavin_Reduct| HM:PFM:NREP 2 HM:PFM:REP 20->163|PF01613|4e-29|33.3|144/155|Flavin_Reduct| HM:PFM:REP 185->226|PF11220|0.00025|33.3|42/144|DUF3015| RP:SCP:NREP 1 RP:SCP:REP 12->162|1wgbA|6e-41|24.8|149/159|b.45.1.2| HM:SCP:REP 8->173|1uscA_|1.3e-41|34.8|164/178|b.45.1.2|1/1|FMN-binding split barrel| OP:NHOMO 436 OP:NHOMOORG 230 OP:PATTERN ------1111111111-1-------------------------------------------------- --1-5--12231--22233-331133333333523263GE-3141-------44--11--222-4122321-----------2-----------------------------------------------------11111---1-------1------------------11-11--1-1-1--------3-----------------1---------1211--------------------------------------------------------------------------------------------------------------------------------1---------------------1--211--------2-112----3---------------------2-1-233321112243142211112121222-------------11111111111----1111111111111------3-1-411112333332111133112211213142422--1121111121-131111-----------------32-----------------------------1--------------------------------------1--------1------1-----------------------------------------------------1---------------------------------------------------------------2--1------------33323-3---1-----422323433-111------------------------11----------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1-------11------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 222 STR:RPRED 56.6 SQ:SECSTR HHHHTTTccccccccHHHHHTTccEEcEEEEEEETTTEEEEEEEcccEEEEETTEEEEEEEETTTTTTHHHHTccEEEEEEEccHHHHHHHHHccTTTTGGGcccEEEcGGGcEEETTEEEEEEEEEEEEEEETTEEEEEEEEEEEEEcccccccEEETTEEEccEcccccccTTTEcccccccTTTTT#######################################################EEEcccEEcccccEEEEcccE##EEEEEEccccEE################################################################################################################# DISOP:02AL 1-11,391-393| PSIPRED ccccccccccccHHHHHHHHHHcccccEEEEEEcccccEEEEEEEEEEEEEccccEEEEEEccccHHHHHHHHccEEEEEEccHHHHHHHHHHcccccHHcccccEEEccccccEEcccEEEEEEEEEEEEEcccEEEEEEEEEEEEEccccccEEEEccccccccccHHHHHHHHccccEEEEccccccHHHHccccccEEEEEEEEccccccEEEEEEEcccccHHHHHHcccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHHEEEEEEEcccEEEEEccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHccccccEEEEEEEEEEcccccEEEEEEcccccccccccHHHHHHHHHHHHHHHHcc //