[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55308.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  34/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.17.4
:181 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->154 3b8lB PDBj 2e-05 33.0 %
:RPS:PDB   38->157 3b8lA PDBj 2e-20 30.6 %
:RPS:SCOP  38->158 3b8lA1  d.17.4.28 * 2e-30 30.4 %
:HMM:SCOP  14->163 3stdA_ d.17.4.1 * 1.3e-21 28.9 %
:HMM:PFM   76->109 PF06268 * Fascin 0.00021 29.4 34/109  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55308.1 GT:GENE BAF55308.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2537971..2538516 GB:FROM 2537971 GB:TO 2538516 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55308.1 LENGTH 181 SQ:AASEQ MTNVENLISRIEVLEAEAAIRRIQARYMMLCDTPCPVFPAVSDAERIELVLELYTEDAVWEGVGEYYDNQFGRAEGKDELRAHFNRFWSADQDPKLILNAHYLTSEQIFVDGDTAEGTWIHMQPWLYADGTALLRSSRLFNAFRKEGDSWLITRTRTENVFISSLPNNFAESYPTTSVLFK GT:EXON 1|1-181:0| SEG 15->26|eaeaairriqar| BL:PDB:NREP 1 BL:PDB:REP 40->154|3b8lB|2e-05|33.0|103/137| RP:PDB:NREP 1 RP:PDB:REP 38->157|3b8lA|2e-20|30.6|108/140| HM:PFM:NREP 1 HM:PFM:REP 76->109|PF06268|0.00021|29.4|34/109|Fascin| RP:SCP:NREP 1 RP:SCP:REP 38->158|3b8lA1|2e-30|30.4|112/144|d.17.4.28| HM:SCP:REP 14->163|3stdA_|1.3e-21|28.9|135/0|d.17.4.1|1/1|NTF2-like| OP:NHOMO 35 OP:NHOMOORG 34 OP:PATTERN -------------------------------------------------------------------- ----------1-------------------------1-11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------11111111---------------------------------------12-------1-11111----111------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------11111-----------------1------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 149 STR:RPRED 82.3 SQ:SECSTR ##########################HHHHHHTTcHHHHHHHTTccHHHHHTTEEEEEEEEcGGGTcccEEHHEEcHHHHHHHHHHHHHHEEcEEEEEEEEEEEEEEEEEcccEEEEEEEEEEEEEETTccEEEEEEEEEEEEEEETTEEEEEEEEEEEccccccTTHccHHHHH###### DISOP:02AL 1-2| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHccHHHHHHHcccccccccccccccccccccccHHHHHHHHHcccccccccccEEEEEEcccEEEEEEcccEEEEEEEEEEEccccccEEEEEccEEEEEEEEccEEEEEEEEEEEEEEccccccHHHHcccccEEcc //