[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55312.1
DDBJ      :             hypothetical protein
Swiss-Prot:CLPP1_CORGL  RecName: Full=ATP-dependent Clp protease proteolytic subunit 1;         EC=3.4.21.92;AltName: Full=Endopeptidase Clp 1;

Homologs  Archaea  0/68 : Bacteria  883/915 : Eukaryota  144/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:208 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   13->204 1yg6B PDBj 8e-48 48.2 %
:RPS:PDB   31->202 2cbyB PDBj 4e-46 44.7 %
:RPS:SCOP  25->204 1tg6A1  c.14.1.1 * 3e-25 36.3 %
:HMM:SCOP  20->208 2f6iA1 c.14.1.1 * 1.8e-67 50.8 %
:RPS:PFM   31->202 PF00574 * CLP_protease 4e-50 53.2 %
:HMM:PFM   28->202 PF00574 * CLP_protease 1e-76 56.3 174/182  
:BLT:SWISS 1->208 CLPP1_CORGL e-104 100.0 %
:PROS 100->111|PS00381|CLP_PROTEASE_SER
:PROS 122->135|PS00382|CLP_PROTEASE_HIS
:COIL
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55312.1 GT:GENE BAF55312.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2541789..2542415) GB:FROM 2541789 GB:TO 2542415 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55312.1 LENGTH 208 SQ:AASEQ MSNGFQMPTSRYVLPSFIEQSAYGTKETNPYAKLFEERIIFLGTQVDDTSANDIMAQLLVLEGMDPDRDITLYINSPGGSFTALMAIYDTMQYVRPDVQTVCLGQAASAAAVLLAAGAPGKRAVLPNSRVLIHQPATQGTQGQVSDLEIQAAEIERMRRLMETTLAEHTGKTAEQIRIDTDRDKILTAEEALEYGIVDQVFDYRKLKR GT:EXON 1|1-208:0| SW:ID CLPP1_CORGL SW:DE RecName: Full=ATP-dependent Clp protease proteolytic subunit 1; EC=3.4.21.92;AltName: Full=Endopeptidase Clp 1; SW:GN Name=clpP1; OrderedLocusNames=Cgl2411, cg2644; SW:KW ATP-binding; Complete proteome; Cytoplasm; Hydrolase;Nucleotide-binding; Protease; Serine protease. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->208|CLPP1_CORGL|e-104|100.0|208/208| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0008233|"GO:peptidase activity"|Protease| GO:SWS GO:0008236|"GO:serine-type peptidase activity"|Serine protease| PROS 100->111|PS00381|CLP_PROTEASE_SER|PDOC00358| PROS 122->135|PS00382|CLP_PROTEASE_HIS|PDOC00358| COIL:NAA 35 COIL:NSEG 1 COIL:REGION 140->174| SEG 103->120|lgqaasaaavllaagapg| BL:PDB:NREP 1 BL:PDB:REP 13->204|1yg6B|8e-48|48.2|191/192| RP:PDB:NREP 1 RP:PDB:REP 31->202|2cbyB|4e-46|44.7|161/170| RP:PFM:NREP 1 RP:PFM:REP 31->202|PF00574|4e-50|53.2|171/179|CLP_protease| HM:PFM:NREP 1 HM:PFM:REP 28->202|PF00574|1e-76|56.3|174/182|CLP_protease| GO:PFM:NREP 2 GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF00574|IPR001907| GO:PFM GO:0006508|"GO:proteolysis"|PF00574|IPR001907| RP:SCP:NREP 1 RP:SCP:REP 25->204|1tg6A1|3e-25|36.3|179/184|c.14.1.1| HM:SCP:REP 20->208|2f6iA1|1.8e-67|50.8|187/0|c.14.1.1|1/1|ClpP/crotonase| OP:NHOMO 1680 OP:NHOMOORG 1027 OP:PATTERN -------------------------------------------------------------------- 1112422222222222222-222222222222222244442445442222222222242233423225532222222211121111111111111111-11112211122222222222222222111111111112222211111344344433444444444432444444444444444411111112211222222222233222222211222111111122222233211111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111112111111112112111111211112111122111111111111111112111211111112211111111111111111112-1121111122213332332333331122111211111112222222222221121111111111111111111111111111111111111111211111111111112211111121211111111111111211121111111111111111111111111111111111111111111111111112211111111111111111111111111111111111111111111111111111111111111111111111111111221111111111--1111111111111111111111111111111111111111112111111111111111111111111111111111121211111111111111111111111111111222211111111111111111111111111111111111111211111111111111112222222222222222--------------------------1111111111121 22----121---1111111111111111111111111111111-1111111111111111111----------1---------------1211111111111-111-1C-21111211-1--111-1--151-1-111--11111-1-1-1---1--111111111-111512225756*78979JCKK19C6631117 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 207 STR:RPRED 99.5 SQ:SECSTR HHccETTTTEEcEEETTTcccccccccccEHHHHHHTTEEEEcccccHHHHHHHHHHHHHHHHHcTTccEEEEEEEccccHHHHHHHHHHHHHccccEEEEEEEEEETHHHHHHHTccTTcEEEcTTcEEEccccGGccTTccccccHHHHHHHHHHHHHHHHHHHHHHTccHHHHHHHHHTTcEEEHHHHHHHTcccEEccccccH# DISOP:02AL 1-10,205-209| PSIPRED cccccccccccccccEEccccccccccccHHHHHHcccEEEEcccccHHHHHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHccccccEEEccccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccccccHHHHHHcccccEEccHHHccc //