[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55321.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:120 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   95->112 PF03597 * CcoS 0.00077 27.8 18/45  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55321.1 GT:GENE BAF55321.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2549003..2549365 GB:FROM 2549003 GB:TO 2549365 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55321.1 LENGTH 120 SQ:AASEQ MRDWELRIQLIKSWNRWAWWSLDRVLVVVALQVVQRHRVVPFVVVAVFSHGAGTYRAVGSCSFHLVWCSPRVYHRLVLGWGCCLVLMGLWLAEHIFVGLVLVGLCFWAAKSTHFSLNPLF GT:EXON 1|1-120:0| TM:NTM 3 TM:REGION 15->36| TM:REGION 38->60| TM:REGION 87->109| SEG 24->48|rvlvvvalqvvqrhrvvpfvvvavf| HM:PFM:NREP 1 HM:PFM:REP 95->112|PF03597|0.00077|27.8|18/45|CcoS| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED cccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHcccccEEEEEEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEccccc //