[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55325.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  64/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:203 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   5->163 1bedA PDBj 9e-06 18.6 %
:RPS:SCOP  1->161 1r4wA  c.47.1.13 * 5e-20 18.6 %
:HMM:SCOP  1->163 1r4wA_ c.47.1.13 * 5.9e-23 27.2 %
:RPS:PFM   8->134 PF01323 * DSBA 6e-06 33.3 %
:HMM:PFM   4->161 PF01323 * DSBA 5.4e-11 21.3 150/193  
:BLT:SWISS 5->197 Y2286_MYCTU 7e-18 32.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55325.1 GT:GENE BAF55325.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2552128..2552739) GB:FROM 2552128 GB:TO 2552739 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55325.1 LENGTH 203 SQ:AASEQ MAQKVTFWFDTTCPFCWVTSRWIKEVEQVRDIEIQWVPMSLAVLNDGRDLPEDYKERMKAAWGPARVFAAVATDHADKLGDLYTAMGTRIHNDGRGPIEGSFNDVIAGALEEVGLDAALGEVADTTEWDDALRAFHQTAMDEVGNDVGTPVVKLGDTAFFGPVLTRIPRGEEAGEIFDASFKLASYPHFFEIKRSRTENPQFD GT:EXON 1|1-203:0| BL:SWS:NREP 1 BL:SWS:REP 5->197|Y2286_MYCTU|7e-18|32.1|187/230| RP:PDB:NREP 1 RP:PDB:REP 5->163|1bedA|9e-06|18.6|140/181| RP:PFM:NREP 1 RP:PFM:REP 8->134|PF01323|6e-06|33.3|120/178|DSBA| HM:PFM:NREP 1 HM:PFM:REP 4->161|PF01323|5.4e-11|21.3|150/193|DSBA| GO:PFM:NREP 2 GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF01323|IPR001853| GO:PFM GO:0030288|"GO:outer membrane-bounded periplasmic space"|PF01323|IPR001853| RP:SCP:NREP 1 RP:SCP:REP 1->161|1r4wA|5e-20|18.6|156/221|c.47.1.13| HM:SCP:REP 1->163|1r4wA_|5.9e-23|27.2|158/0|c.47.1.13|1/1|Thioredoxin-like| OP:NHOMO 80 OP:NHOMOORG 64 OP:PATTERN -------------------------------------------------------------------- ---1111111111121111-1111312121222222211111-11111111-11111211122-2111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 140 STR:RPRED 69.0 SQ:SECSTR ####EEEEEcTTcHHHHHHHHHHHHHHHTccTTcEEEEE##############EcccccGGGHHHHHHHHHHHHHTTcHHHHHHHHHHHHTTccccc###ccHHHHHHHHHTTTccHHHHHHHTcHHHHHHHHHHHHHHHH##HTcccccEEEETTTEEEcGG######################################## DISOP:02AL 1-1,196-204| PSIPRED cccEEEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccEEEEccEEEEccccccccccHHHHHHHHHHHHHHccccEEEEEcccccccccc //