[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55329.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   28->58 PF07407 * Seadorna_VP6 7e-04 48.4 %
:HMM:PFM   2->50 PF01527 * Transposase_8 2.6e-07 42.2 45/76  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55329.1 GT:GENE BAF55329.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2557188..2557364) GB:FROM 2557188 GB:TO 2557364 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55329.1 LENGTH 58 SQ:AASEQ MAEELGVSAGLLGRWVKAERERTGEGADYLGEISANERQEPIRLRKENAELKLDNELL GT:EXON 1|1-58:0| RP:PFM:NREP 1 RP:PFM:REP 28->58|PF07407|7e-04|48.4|31/385|Seadorna_VP6| HM:PFM:NREP 1 HM:PFM:REP 2->50|PF01527|2.6e-07|42.2|45/76|Transposase_8| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------1---1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,19-33| PSIPRED ccHHHcHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //