[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55360.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:124 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   36->52 PF12586 * DUF3760 0.00068 47.1 17/46  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55360.1 GT:GENE BAF55360.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2590301..2590675 GB:FROM 2590301 GB:TO 2590675 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55360.1 LENGTH 124 SQ:AASEQ MRRNFFRPLCQFPVRAPPDGPGFSLPIGGAAVPALIKVTMISCDHYQLVLPELVGASWHFRKNLLHVSVYPANRISVFVACQAKNMADIIDFTEVHKSRIKILLPERSCSDRGAHSPKFHHHAR GT:EXON 1|1-124:0| HM:PFM:NREP 1 HM:PFM:REP 36->52|PF12586|0.00068|47.1|17/46|DUF3760| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,111-125| PSIPRED cccHHHHHHHcccccccccccccccccccccccEEEEEEEEEcccEEEEcHHHHccccEEEccEEEEEEEcccEEEEEEEEccccHHHHHHHHHHHHcEEEEEEEcccccccccccccHHHccc //