[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55361.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.76.1
:67 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   20->59 2gsnA PDBj 9e-05 37.5 %
:RPS:PDB   11->54 1ei6A PDBj 6e-04 18.2 %
:RPS:SCOP  19->52 1ei6A  c.76.1.4 * 6e-05 23.5 %
:HMM:SCOP  6->58 2i09A1 c.76.1.5 * 6.8e-05 27.5 %
:RPS:PFM   3->54 PF01663 * Phosphodiest 2e-04 36.5 %
:HMM:PFM   5->60 PF01663 * Phosphodiest 3.8e-10 37.5 56/364  
:BLT:SWISS 12->59 ENPP7_HUMAN 7e-05 35.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55361.1 GT:GENE BAF55361.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2590442..2590645) GB:FROM 2590442 GB:TO 2590645 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55361.1 LENGTH 67 SQ:AASEQ MSSSIATAALRQKDFDAGFVYFGEIDDVGHIFGLAGDEYRDAIRRVDAHVKKVLSEVPRRSDELGED GT:EXON 1|1-67:0| BL:SWS:NREP 1 BL:SWS:REP 12->59|ENPP7_HUMAN|7e-05|35.4|48/458| BL:PDB:NREP 1 BL:PDB:REP 20->59|2gsnA|9e-05|37.5|40/382| RP:PDB:NREP 1 RP:PDB:REP 11->54|1ei6A|6e-04|18.2|44/404| RP:PFM:NREP 1 RP:PFM:REP 3->54|PF01663|2e-04|36.5|52/308|Phosphodiest| HM:PFM:NREP 1 HM:PFM:REP 5->60|PF01663|3.8e-10|37.5|56/364|Phosphodiest| GO:PFM:NREP 1 GO:PFM GO:0003824|"GO:catalytic activity"|PF01663|IPR002591| RP:SCP:NREP 1 RP:SCP:REP 19->52|1ei6A|6e-05|23.5|34/404|c.76.1.4| HM:SCP:REP 6->58|2i09A1|6.8e-05|27.5|51/0|c.76.1.5|1/1|Alkaline phosphatase-like| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 49 STR:RPRED 73.1 SQ:SECSTR ##########HHHTTcccEEEEEcccHHHHHccTTcHHHHHHHHHHHHHHHHHHHHHHH######## DISOP:02AL 1-3,58-68| PSIPRED ccHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //