[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55369.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:213 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   21->65 PF04854 * DUF624 0.0001 26.7 45/77  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55369.1 GT:GENE BAF55369.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2598790..2599431) GB:FROM 2598790 GB:TO 2599431 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55369.1 LENGTH 213 SQ:AASEQ MNRILGPESKFYAALSLFADLVIVNVLLVITCFPVFTGGMSLRTAHAVTGQMVREEGSRRGSAFVRGLLTRPGVNTAWWLISLAVAALAAYEFAIIAKADLGSMGLILRAALISGLIVLGSVSVWFFHLDAPGLGFRQRITQAMMKAVGHLPRTLLAILPGIVLVLYPVFFPAQWGGYLFFLAVLGPALAVYLAELVLQWPELNSQTPDSPSA GT:EXON 1|1-213:0| TM:NTM 5 TM:REGION 15->37| TM:REGION 75->97| TM:REGION 105->127| TM:REGION 149->171| TM:REGION 179->201| SEG 77->99|awwlislavaalaayefaiiaka| HM:PFM:NREP 1 HM:PFM:REP 21->65|PF04854|0.0001|26.7|45/77|DUF624| OP:NHOMO 4 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- -----1--111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,54-60,203-214| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccc //