[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55387.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:91 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55387.1 GT:GENE BAF55387.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2616232..2616507 GB:FROM 2616232 GB:TO 2616507 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55387.1 LENGTH 91 SQ:AASEQ MEWSTLITVTEQDTWLRRLRRGRGFAGDKLSASWNLSLTTCSGQGDTHRTRRLLEPEPQTESGDRKAFTASPPPLMTTLSSMLNSACTNVP GT:EXON 1|1-91:0| SEG 16->24|lrrlrrgrg| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- --------1-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,52-68,90-92| PSIPRED ccccEEEEEEccHHHHHHHHHcccccccccccEEEEEEEEEcccccHHHHHHcccccccccccccEEEccccccHHHHHHHHHHHHHcccc //