[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55405.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  321/915 : Eukaryota  140/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:167 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->38 2shkB PDBj 2e-04 50.0 %
:BLT:PDB   29->165 1ko5A PDBj 9e-27 43.8 %
:RPS:PDB   5->136 1akyA PDBj 2e-10 15.2 %
:RPS:SCOP  9->165 1knqA  c.37.1.17 * 6e-21 44.6 %
:HMM:SCOP  1->166 1knqA_ c.37.1.17 * 4.2e-25 25.9 %
:RPS:PFM   16->156 PF01202 * SKI 8e-10 40.4 %
:HMM:PFM   15->153 PF01202 * SKI 1e-15 27.6 134/158  
:BLT:SWISS 6->164 IDNK_ECOLI 5e-33 44.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55405.1 GT:GENE BAF55405.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2635877..2636380 GB:FROM 2635877 GB:TO 2636380 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55405.1 LENGTH 167 SQ:AASEQ MSAAEGLHIVIMGVSGCGKSSVGEALAAELGIEYKDGDELHPQENIDKMASGRALDDDDRAWWLVQVGKWLRGRPSGVIACSALKRSYRDLLRTKCPGTVFVHLHGDYDLLLSRMKAREDHFMPSTLLDSQFATLEPLEDDEDGKVFDVAHTISELAAQSAEWVRNK GT:EXON 1|1-167:0| BL:SWS:NREP 1 BL:SWS:REP 6->164|IDNK_ECOLI|5e-33|44.0|159/187| BL:PDB:NREP 2 BL:PDB:REP 9->38|2shkB|2e-04|50.0|30/162| BL:PDB:REP 29->165|1ko5A|9e-27|43.8|137/172| RP:PDB:NREP 1 RP:PDB:REP 5->136|1akyA|2e-10|15.2|132/218| RP:PFM:NREP 1 RP:PFM:REP 16->156|PF01202|8e-10|40.4|136/156|SKI| HM:PFM:NREP 1 HM:PFM:REP 15->153|PF01202|1e-15|27.6|134/158|SKI| GO:PFM:NREP 2 GO:PFM GO:0004765|"GO:shikimate kinase activity"|PF01202|IPR000623| GO:PFM GO:0005524|"GO:ATP binding"|PF01202|IPR000623| RP:SCP:NREP 1 RP:SCP:REP 9->165|1knqA|6e-21|44.6|157/171|c.37.1.17| HM:SCP:REP 1->166|1knqA_|4.2e-25|25.9|166/0|c.37.1.17|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 568 OP:NHOMOORG 461 OP:PATTERN -------------------------------------------------------------------- 11--2111111111111----1--11-----111111222----11--121-2321-1----11-1121111---111--------------------------1-1-------------------------------------1-111111--------------11111--------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------2111111111111----------1-11-12-1111--111321122212-11-1--1-------1111111112211-------------------------------------1-----1111111111111121111121111111--1111-1111111---------1-1111111--------------------------------1-11-----------------------------112--11-112-1111----------1----------------11211112112221212-1121212122112222221121111112222222222212122211111121-222222222222---------------111111111-----11111111111---2111111111111111111----------1-1-1111111111--11111111-------------------------------------------------------------1- ----111-2---1111111121222221111-111-11111-111111332232211112221111111111111111-111111111-1211111111111-111---1---11--1--11111111-451-112111-1-1---1--11-1111112---111------1111-1--4----11--1111------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 167 STR:RPRED 100.0 SQ:SECSTR ccTccccEEEEEccTTccHHHHHHHHHHHHccEEEEHHHHHHHHHHTTcHHHHHHHHHHHTTcccHHHHcGGGGccEEEEcccccHHHHHHHHHTccccEEEEEEccHHHHHHHHHTEEEcTTTccEEETTTccccHHHTTTTEEEEEccccHHHHHHHHHHHTTHT DISOP:02AL 1-4,167-168| PSIPRED cccccccEEEEEccccccHHHHHHHHHHHHccEEEEccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHcccccEEEEEEccHHHHHHHHHHcccccccHHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHHcc //