[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55419.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  33/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:154 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->79 PF07895 * DUF1673 0.00061 17.6 68/205  
:BLT:SWISS 37->74 Y1343_MYCTU 7e-13 71.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55419.1 GT:GENE BAF55419.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2654716..2655180 GB:FROM 2654716 GB:TO 2655180 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55419.1 LENGTH 154 SQ:AASEQ MSEPGPSGVKEKKKVKASHIVFLLICFIAACALAWWQWSRFQSGSGTFQNLGYAFQWPLIGAFFVYAYRKYLQYENESIELENMEAKMMAEQGKTPVAQSEQEDSFVQLSHRPSLVEDDSVKEIDESFLPSRPTMDVEEFNRLNDPHARRRRKA GT:EXON 1|1-154:0| BL:SWS:NREP 1 BL:SWS:REP 37->74|Y1343_MYCTU|7e-13|71.1|38/126| TM:NTM 2 TM:REGION 16->35| TM:REGION 47->68| SEG 22->36|fllicfiaacalaww| HM:PFM:NREP 1 HM:PFM:REP 11->79|PF07895|0.00061|17.6|68/205|DUF1673| OP:NHOMO 33 OP:NHOMOORG 33 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-1111111111111111-111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-14,81-82,86-104,143-155| PSIPRED cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccccccHHHHHHHHHccccccccccHHHHHHHHccccccccHHHHcccccHHHHHHHcc //