[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55436.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:297 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   27->75 PF12355 * Dscam_C 6e-04 41.7 %
:HMM:PFM   178->273 PF06790 * UPF0259 7.6e-07 31.6 95/248  
:HMM:PFM   90->110 PF12459 * DUF3687 2.8e-05 28.6 21/42  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55436.1 GT:GENE BAF55436.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2669014..2669907) GB:FROM 2669014 GB:TO 2669907 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55436.1 LENGTH 297 SQ:AASEQ MTSPYGSQYPGDDNNNWNSQFGNLSGEQNYGQPYGAPYGQPYGQPFDQGFNAYSSPIPPEVPQPSMQEAQWRSFDLGTVFGQAWKGFAATWQAWVLSTLIYFAVILVLMFAWIIPMVGVLAATSSGSDSAAIAAAGGTSFFGFVLMIVLVFISFVYSLNCYRNAARVVRGEQITIQSFFKMKGLGKALGIYILVNIVIFIGMILLLIPGIIAAVVLVFAVPVAFQLRDASIGDAFSASWKVVSKNVGQTILLFLVIFVLSFLGSAVIIGMLVTTPLTFLLYAYAFQTASGGPIMQRQ GT:EXON 1|1-297:0| TM:NTM 4 TM:REGION 98->120| TM:REGION 133->155| TM:REGION 195->217| TM:REGION 255->277| SEG 121->143|aatssgsdsaaiaaaggtsffgf| SEG 198->224|ifigmilllipgiiaavvlvfavpvaf| SEG 250->262|illflvifvlsfl| RP:PFM:NREP 1 RP:PFM:REP 27->75|PF12355|6e-04|41.7|48/124|Dscam_C| HM:PFM:NREP 2 HM:PFM:REP 178->273|PF06790|7.6e-07|31.6|95/248|UPF0259| HM:PFM:REP 90->110|PF12459|2.8e-05|28.6|21/42|DUF3687| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,6-6,63-65,67-67,295-298| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc //