[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55449.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  184/915 : Eukaryota  0/199 : Viruses  3/175   --->[See Alignment]
c.47.1
:77 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->72 1r7hA PDBj 9e-32 77.8 %
:RPS:PDB   1->72 2ct6A PDBj 1e-09 20.0 %
:RPS:SCOP  1->75 1h75A  c.47.1.1 * 3e-30 42.7 %
:HMM:SCOP  1->76 1h75A_ c.47.1.1 * 1.7e-19 36.8 %
:RPS:PFM   3->60 PF00462 * Glutaredoxin 2e-07 39.7 %
:HMM:PFM   3->61 PF00462 * Glutaredoxin 1.3e-20 39.0 59/60  
:BLT:SWISS 1->72 NRDH_SALTY 2e-16 44.4 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55449.1 GT:GENE BAF55449.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2682515..2682748) GB:FROM 2682515 GB:TO 2682748 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55449.1 LENGTH 77 SQ:AASEQ MAITVYTKPACVQCNATKKALDRAGLEYDLVDISLDEEAREYVLALGYLQAPVVVADGSHWSGFRPERIREMATAAA GT:EXON 1|1-77:0| BL:SWS:NREP 1 BL:SWS:REP 1->72|NRDH_SALTY|2e-16|44.4|72/81| BL:PDB:NREP 1 BL:PDB:REP 1->72|1r7hA|9e-32|77.8|72/74| RP:PDB:NREP 1 RP:PDB:REP 1->72|2ct6A|1e-09|20.0|70/111| RP:PFM:NREP 1 RP:PFM:REP 3->60|PF00462|2e-07|39.7|58/60|Glutaredoxin| HM:PFM:NREP 1 HM:PFM:REP 3->61|PF00462|1.3e-20|39.0|59/60|Glutaredoxin| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00462|IPR002109| GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF00462|IPR002109| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00462|IPR002109| RP:SCP:NREP 1 RP:SCP:REP 1->75|1h75A|3e-30|42.7|75/76|c.47.1.1| HM:SCP:REP 1->76|1h75A_|1.7e-19|36.8|76/76|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 199 OP:NHOMOORG 187 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11111211111111123232----111-1---223111--------------111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1111-111-1---------1-11111111-1111-1-1111111---------------------------------------------------------11111-------------11111111111-------------111111-111---------1-----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11-1-111111111--1-1111111111111111111-11111111111111111111111111111111-11111111-111----------------1------------------------------------------------------------------1--------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- -----------------------------------------------------------------------------------------1----1-1------------------------------------------------------------------------------ STR:NPRED 75 STR:RPRED 97.4 SQ:SECSTR ccEEEEEccccccHHHHHHHHHHTTccEEEEETTTcHHHHHHHHHcccccccEEEETTEEEEEHHHHHHHHHHHT## DISOP:02AL 77-78| PSIPRED cEEEEEEccccHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHccccccEEEEccEEEEcccHHHHHHHHHHcc //