[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55450.1
DDBJ      :             hypothetical protein
Swiss-Prot:RL36_CORGL   RecName: Full=50S ribosomal protein L36;

Homologs  Archaea  0/68 : Bacteria  28/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
g.42.1
:40 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->40 3bbo6 PDBj 1e-04 47.4 %
:RPS:PDB   1->40 3bbo6 PDBj 1e-04 50.0 %
:HMM:SCOP  1->40 2i2t41 g.42.1.1 * 1e-10 57.9 %
:HMM:PFM   1->40 PF00444 * Ribosomal_L36 8e-19 56.8 37/38  
:BLT:SWISS 1->40 RL36_CORGL 8e-19 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55450.1 GT:GENE BAF55450.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2683319..2683441) GB:FROM 2683319 GB:TO 2683441 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55450.1 LENGTH 40 SQ:AASEQ MKVRNSLRSLKNKPGAQVVRRRGKVYVINKKEPRFKARQG GT:EXON 1|1-40:0| SW:ID RL36_CORGL SW:DE RecName: Full=50S ribosomal protein L36; SW:GN Name=rpmJ; OrderedLocusNames=Cgl2533, cg2791; SW:KW Complete proteome; Ribonucleoprotein; Ribosomal protein. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->40|RL36_CORGL|8e-19|100.0|40/40| GO:SWS:NREP 2 GO:SWS GO:0030529|"GO:ribonucleoprotein complex"|Ribonucleoprotein| GO:SWS GO:0005840|"GO:ribosome"|Ribosomal protein| BL:PDB:NREP 1 BL:PDB:REP 1->40|3bbo6|1e-04|47.4|38/38| RP:PDB:NREP 1 RP:PDB:REP 1->40|3bbo6|1e-04|50.0|38/38| HM:PFM:NREP 1 HM:PFM:REP 1->40|PF00444|8e-19|56.8|37/38|Ribosomal_L36| HM:SCP:REP 1->40|2i2t41|1e-10|57.9|38/0|g.42.1.1|1/1|Ribosomal protein L36| OP:NHOMO 28 OP:NHOMOORG 28 OP:PATTERN -------------------------------------------------------------------- ------11111111-------------------------1----1---11111-11-1--------1-1------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11-----1---------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 40 STR:RPRED 100.0 SQ:SECSTR cccccccccccccTTcccEEETTEEEccccccGGGccccc DISOP:02AL 1-10,35-41| PSIPRED ccHHHHHHHHHcccHHHHHHHcccEEEEEcccccHHHccc //