[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55458.1
DDBJ      :             hypothetical protein
Swiss-Prot:CRCB2_CORGL  RecName: Full=Protein crcB homolog 2;

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:108 amino acids
:PSIPRED
:HMM:PFM   3->106 PF02537 * CRCB 3e-24 38.5 104/117  
:BLT:SWISS 17->107 CRCB2_CORGL 2e-40 96.7 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55458.1 GT:GENE BAF55458.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2690646..2690972 GB:FROM 2690646 GB:TO 2690972 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55458.1 LENGTH 108 SQ:AASEQ MIFFYAALGGFFGGFLRWSLAQLFPGKRATLAANTLACLAGGFFVSLDLAHLYTVLLIASFCGALSTWSTLAKELGQLLNEKKWWPMLGYLSLTFALGYSAVFLGMRF GT:EXON 1|1-108:0| SW:ID CRCB2_CORGL SW:DE RecName: Full=Protein crcB homolog 2; SW:GN Name=crcB2; OrderedLocusNames=Cgl2543, cg2802; SW:KW Cell membrane; Complete proteome; Membrane; Transmembrane. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 17->107|CRCB2_CORGL|2e-40|96.7|91/108| GO:SWS:NREP 3 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| TM:NTM 4 TM:REGION 3->25| TM:REGION 30->52| TM:REGION 56->78| TM:REGION 84->105| SEG 3->16|ffyaalggffggfl| SEG 29->40|atlaantlacla| HM:PFM:NREP 1 HM:PFM:REP 3->106|PF02537|3e-24|38.5|104/117|CRCB| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED ccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccHHHEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccc //