[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55463.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  68/68 : Bacteria  907/915 : Eukaryota  195/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:284 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   50->261 1l2tB PDBj 5e-41 39.6 %
:RPS:PDB   50->275 3b5jA PDBj 3e-44 25.6 %
:RPS:SCOP  50->275 1b0uA  c.37.1.12 * 2e-37 29.7 %
:HMM:SCOP  50->262 1ii8.1 c.37.1.12 * 2.3e-62 40.1 %
:RPS:PFM   89->211 PF00005 * ABC_tran 9e-17 44.8 %
:HMM:PFM   89->211 PF00005 * ABC_tran 1.3e-23 37.1 116/118  
:HMM:PFM   61->97 PF03193 * DUF258 3.9e-06 27.8 36/161  
:BLT:SWISS 49->262 LOLD_GEOMG 2e-43 43.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55463.1 GT:GENE BAF55463.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2696875..2697729) GB:FROM 2696875 GB:TO 2697729 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55463.1 LENGTH 284 SQ:AASEQ MSNPAASTPANNSDDVAKENWDSSFTPKTEIDSSQPVNNSTGEAAARAVNLYKAYGQGDTTVTALDHVNVEFEKNKFTAIMGPSGSGKSTLMHCMAGLDAATGGSAFIGDTDLSQLKDKAMTSLRRDRLGFIFQSFNLVPTLTASENITLPTDIAGRKIDQSWFDEITSRLGLNERLKHRPAELSGGQQQRVACARALVSRPEIIFGDEPTGNLDSNSSREVLDILRTAVDQDDQTVVIVTHDAKAASYADRVIFLADGRIVNQLFDPTIEEILATMNGIEDIA GT:EXON 1|1-284:0| BL:SWS:NREP 1 BL:SWS:REP 49->262|LOLD_GEOMG|2e-43|43.0|214/225| SEG 230->243|vdqddqtvvivthd| BL:PDB:NREP 1 BL:PDB:REP 50->261|1l2tB|5e-41|39.6|212/232| RP:PDB:NREP 1 RP:PDB:REP 50->275|3b5jA|3e-44|25.6|219/243| RP:PFM:NREP 1 RP:PFM:REP 89->211|PF00005|9e-17|44.8|116/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 89->211|PF00005|1.3e-23|37.1|116/118|ABC_tran| HM:PFM:REP 61->97|PF03193|3.9e-06|27.8|36/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 50->275|1b0uA|2e-37|29.7|219/258|c.37.1.12| HM:SCP:REP 50->262|1ii8.1|2.3e-62|40.1|207/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 41968 OP:NHOMOORG 1170 OP:PATTERN PPH8JFFBSSSPRMTKcGKKJLITsOTdiZYSH9DBBAGEFDBRZPUjHM*oZ8LSLSUJMJHBR178 MWfK*cYdhhkTXQVORMM-Me88U*MMMMMKqgfhn***S*X*n*meriaLutqLOa89osxd*ks***cWVVVtVVVNsceBAC9CNMOG5IEGD--AEPHHHXGTKN678787789AAAAAFSMIPSLJQRUPdlmqtHGGrWidbiWVgSWNPHCJBLDVVUdy**WEJEGDBCKCFHAWQUNLoc8QYo********u********uuws***Xdp*zdhnklfhk**VfghgieeffffffeVaXWYqcUTvvSLZVhpoLMx*WQLVhecddkhkklfnjmlhmhidejmeihVUVUTVVWWVVUUnfhbbbhfifi*o*********b*ei*zzXYYV*lgkqybhNJ**kbTXfeOYcWgbJWUXKVUPPKFGGFIbV***STj****z*******u***-ij*fc*e***PA**************IGI**********QPQQQQQQoYcFQbS*54554444554366986696686696564JBCFCDx**t*******rssun*****x*zdz***xy*v9Itslwhnhl*z****SlfNWGPgSHHIHIHGONKWjeZm*McQngTclWUeGYYTSTTcRWTRTVktXqKFHNFKKKLHEB9DEDCEBBEPEEHNMkhoKrScISJtOSWWTGRYTRQQPRUSTXW5-DHNMK33-222*t**O*uw***x*z*vw-*wvyxxyyvz**xrsvsru*****Xdejmiijjkkjiggkgih*ojjqqppQ4************23GHCDBCDKJLKLHzi*SSRXSVFLLIJSLPaNPROPFOGLSkcopnpt***oz*rta***FFFDEEFEFJcmjtnpppox*ytuMNNKKLKHJIBAAA23FUOOEEGH98787889*9PB9AA7-8B97BB9JIG79F7A7666PckPPe*ghdCWL --22UQB-ME69EQMEAD86GJFK9JGEE7989IGF8D9B9BC999DCDNKDOFABG9D9AB83633415448754513566655633-AC5A7756677817HD93FUdTFKIWOMDB86CMCjh4h7**b3cKeF8A6X8ETP6H999SA5*BPNGgDY*GYIW6mTX*NZND7A98*8AAAHfQU*AvbFEiTbaK ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,8-44,281-285| PSIPRED cccccccccccccccHHHHHcccccccccccccccccccccccEEEEEEEEEEEEccccEEEEEEcccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEHHcccHHHHHHHHHHHccEEEEEccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHccHHHccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHHHccEEEEEcccHHHHHHccEEEEEEccEEEEEEccccHHHHHHHcccccccc //