[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55485.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  10/68 : Bacteria  398/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.7.12
:218 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->184 1t8bA PDBj 2e-19 32.0 %
:RPS:PDB   39->190 3bg2A PDBj 3e-06 10.6 %
:RPS:SCOP  24->184 1t72A  a.7.12.1 * 8e-37 28.3 %
:HMM:SCOP  1->200 1sumB_ a.7.12.1 * 6.2e-37 29.8 %
:RPS:PFM   1->75 PF01895 * PhoU 1e-04 32.0 %
:HMM:PFM   2->77 PF01895 * PhoU 2.3e-07 28.0 75/88  
:HMM:PFM   96->177 PF01895 * PhoU 8.9e-12 29.3 82/88  
:BLT:SWISS 1->187 PHOU2_MYCTU 1e-48 46.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55485.1 GT:GENE BAF55485.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2731706..2732362 GB:FROM 2731706 GB:TO 2732362 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55485.1 LENGTH 218 SQ:AASEQ MDKATDALLRTSLASAESALGNAEKLEELRTGCESQAVELLALETPVARDLRQVVSSIYIVEEITRMGALAMHVANSVRRRYPDPVIPEDMRGYFKEIARLAADMTDHIRQILIDPEPDLALEMAKSDDAVDDLHQHIMRILTLRPWPHDTKSAVDLTLLSRFYERYADHTVNVAARIIYLSTGLHPEEYMEKREQQRADADMEKRWAELERQFRTSE GT:EXON 1|1-218:0| BL:SWS:NREP 1 BL:SWS:REP 1->187|PHOU2_MYCTU|1e-48|46.5|187/213| BL:PDB:NREP 1 BL:PDB:REP 1->184|1t8bA|2e-19|32.0|181/208| RP:PDB:NREP 1 RP:PDB:REP 39->190|3bg2A|3e-06|10.6|141/397| RP:PFM:NREP 1 RP:PFM:REP 1->75|PF01895|1e-04|32.0|75/89|PhoU| HM:PFM:NREP 2 HM:PFM:REP 2->77|PF01895|2.3e-07|28.0|75/88|PhoU| HM:PFM:REP 96->177|PF01895|8.9e-12|29.3|82/88|PhoU| RP:SCP:NREP 1 RP:SCP:REP 24->184|1t72A|8e-37|28.3|159/215|a.7.12.1| HM:SCP:REP 1->200|1sumB_|6.2e-37|29.8|198/0|a.7.12.1|1/1|PhoU-like| OP:NHOMO 470 OP:NHOMOORG 410 OP:PATTERN ------------------------2---12----1-------------11112--1------------ 21--111111111122223-42112222222221112145111111111111111111--111111211111111111----111-----1-----------------1----------------112211112-1-111---1111-1111111---------1--111-------------1111112-12------11111111111-----111--1111111111111111111111111111-1---1111111-1111111111-1--1---2221111111111111111111111111111111--1111111111211---------11111-1112-1-121-11-11-1-2-1221112--111---------11111-1-1-11-------------111111111-1111111111111111-11-1-11111-11111111112211122-----------------------------111111-1111------11111----111111---------111211--1-----111-1--1--------1111-11121-----11--1-31111121-11111113-------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------1-------------------------------------------111111111111--11----------------1--------------------------11--1-11111- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------1------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 87.2 SQ:SECSTR HHHHHHHHHTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHTcGGcTTHHHHHHHHHHHHHHTTTEcccEcHHHHHHHHHHHHHHHHHHHHHHHHHHTTTEEcccccHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHH############################ DISOP:02AL 1-1,187-205,215-219| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHcccccc //