[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55488.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  58/68 : Bacteria  774/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:355 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   112->278 3dhwA PDBj 5e-06 25.9 %
:RPS:PDB   233->276 3dhwA PDBj 2e-13 40.0 %
:RPS:SCOP  93->353 2r6gG1  f.58.1.1 * 1e-15 14.0 %
:RPS:PFM   134->284 PF00528 * BPD_transp_1 2e-08 32.1 %
:HMM:PFM   136->349 PF00528 * BPD_transp_1 2.6e-17 25.2 163/185  
:HMM:PFM   62->143 PF00122 * E1-E2_ATPase 0.00024 28.8 52/228  
:BLT:SWISS 48->350 PSTC2_MYCTU 4e-71 52.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55488.1 GT:GENE BAF55488.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2734191..2735258) GB:FROM 2734191 GB:TO 2735258 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55488.1 LENGTH 355 SQ:AASEQ MATNESVSEKQRLDATRVQAHPVAVNANSSQTKPSKKIVAEGGGSVKRPGDRIFEVLSTASAAIITAIIIAIAAFLIWRAVPALMRNAEGIGGFFTYSGAWNTTDIDAMYFGIPNLLAATLLISVIALIIAMPIALGIAIFLSNYSPKRLVKPLGYMVDMLAAVPSIVYGLWGWQVLGPALSGFYTWIESWGGSFFLFATYQNSPSFATGRNMLTGGIVLAVMILPVIAATAREVFVQTPKGHIESALALGATRWEVVRLTVLPFGMSGYVSGAMLGLGRALGETMALYMVVSPSSAFRFSLFDGGTTFATAIANAAPEFNDNTRAGAYISAGLVLFALTFIVNAGARAMVNRGK GT:EXON 1|1-355:0| BL:SWS:NREP 1 BL:SWS:REP 48->350|PSTC2_MYCTU|4e-71|52.5|297/324| TM:NTM 6 TM:REGION 56->78| TM:REGION 115->137| TM:REGION 158->180| TM:REGION 214->236| TM:REGION 258->280| TM:REGION 327->349| SEG 58->74|stasaaiitaiiiaiaa| BL:PDB:NREP 1 BL:PDB:REP 112->278|3dhwA|5e-06|25.9|139/203| RP:PDB:NREP 1 RP:PDB:REP 233->276|3dhwA|2e-13|40.0|40/203| RP:PFM:NREP 1 RP:PFM:REP 134->284|PF00528|2e-08|32.1|134/195|BPD_transp_1| HM:PFM:NREP 2 HM:PFM:REP 136->349|PF00528|2.6e-17|25.2|163/185|BPD_transp_1| HM:PFM:REP 62->143|PF00122|0.00024|28.8|52/228|E1-E2_ATPase| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 93->353|2r6gG1|1e-15|14.0|228/284|f.58.1.1| OP:NHOMO 1569 OP:NHOMOORG 834 OP:PATTERN 111111--1111111-1-11122144442433222111222222111122411111-11-1---2-22 11--422222221233422-2111322222221111121221222222222211122222113222222222111222-121222211222212--------2--21-1----------------22132422222222242222222213352211122212142364521111111111111111122-2223333333333333332222213331322112111111242111111111111112111211211111111112211111111111333333322233333333333222222222222222222222232231223233332222222-222422233122222532-422211221--222222222222121111111111111111111111-22222221112231131123212213-22212222222122222222222212212212222211---------------2222122221222212222221122222222222222222222-1221221221111123232-2122-------111211125221212223321221221443111112451--21111111---------2222133222211221242222222422222443222--12111------22232232222222222-2222222222222222222222332222222222222222222322222222-233333323333--21---------12232122----1111---222222221111211111-13133311222---------12224444444434411111111111111--21------22222222--2----1---1--11----111--111-1---2-121122 -------------------------------------------------------------------------------------------------------------------------------------------------------------------2------------------------------2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 188 STR:RPRED 53.0 SQ:SECSTR ###############################################################################################################HHHHHHHHHHHHHHHHHHTTGGGHHGGGGGGGTcccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcT#HHHHHHHT####TTTcccccTTcHH#TcccccHHHHHHHHHHHHHHHHHHHHHHcHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTcHHHcTTccHHHHHHHHHHHHc################################################## DISOP:02AL 1-12,14-14,24-50,355-356| PSIPRED ccccHHHHHHHcccHHHHHccccEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //