[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55489.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  29/68 : Bacteria  377/915 : Eukaryota  15/199 : Viruses  2/175   --->[See Alignment]
c.94.1
:375 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   83->370 1ixhA PDBj 7e-29 32.2 %
:RPS:PDB   59->374 2capA PDBj 1e-32 22.3 %
:RPS:SCOP  57->373 1a40A  c.94.1.1 * 3e-52 29.4 %
:HMM:SCOP  56->372 1ixhA_ c.94.1.1 * 1.3e-58 29.4 %
:BLT:SWISS 59->374 PSTS3_MYCTU 2e-66 43.5 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55489.1 GT:GENE BAF55489.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2735403..2736530) GB:FROM 2735403 GB:TO 2736530 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55489.1 LENGTH 375 SQ:AASEQ MNLTLKRSIALVGAVTAGSFALVACSDSNESDSTSSSAASTGSSDAASIEGLSGVTGQLVAEGASSQQSAMDYFGIRYSEAVSGASLAYTPSGSGSGRTNFAAGQVAFGGSDSAMKDDQAAEAEARCNGNEAWHLPFVIGPVAVAYNLPGVDTLNLDTNTIAQIFKGEITKWNDEAIASQNEGTDLPDQDISVLYRSEESGTSDNFQKFLGASTDIWETEGQQFPTEVGSGAQGSNGVASEASNIEGAITYVEAGFANQSGLGVANIDFGSGPVKLNAESVGVALGALDFLTEGHNMVVDTDAMFAMNEAGAYPLILTTYEIVCSAGYDETTRDQVKDFLTVALDSQDDQLEALGYIPVTGEHYDRLVAAVEAIQ GT:EXON 1|1-375:0| BL:SWS:NREP 1 BL:SWS:REP 59->374|PSTS3_MYCTU|2e-66|43.5|315/370| SEG 24->48|acsdsnesdstsssaastgssdaas| BL:PDB:NREP 1 BL:PDB:REP 83->370|1ixhA|7e-29|32.2|273/321| RP:PDB:NREP 1 RP:PDB:REP 59->374|2capA|1e-32|22.3|309/376| RP:SCP:NREP 1 RP:SCP:REP 57->373|1a40A|3e-52|29.4|303/321|c.94.1.1| HM:SCP:REP 56->372|1ixhA_|1.3e-58|29.4|303/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 553 OP:NHOMOORG 423 OP:PATTERN 111111--1111111-1-11122------------11-----------------11-11-1---1-11 21--311111111223433-3122413333341111121111111111111111111111--2111111121111111----111111--1----------------------------------------1--------1------13311233--212122-2-22232121111221111111--11-1-----------------1---------------111111------------------------1----11-111--221----2111------------------------------------------------1-------1-------------------------------------12----------1311111122111------------11111111-1--1--1---11---12-------------2222222211121-----------------------------------1-1111111111111111111321111112131113112221111211211111-2---11-----------21---------------432-1-4-------1-----12---------------1111122-------------------------------------------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--1---------------111----1111---1-------111---11--111-111--111------------------------23222222221111--------------------------------------------------------1-- --------------1---------------------------------------------------------------------------------------------21-----------------------------------------------------4------------23-2221-2-------112---1 -----------------------11------------------------------------------------------------------------------------------------------------------------------------------------------ STR:NPRED 318 STR:RPRED 84.8 SQ:SECSTR ########################################################cEccEEEccTTHHHHTcTTTccTTccHHHHHHHHHHTcGGGTcccTTccccEEEEcccccHHHHHHHHHHHHHccEEEEEEEEEEcccccccccccccEEcHHHHHHHHHTccccGGGcTTcHHcTTccccccccEEEEEccccHHHHHHHHHHHHccGGGTcTTccTTcTTcEEEcHHHHHHHHHHcTTcEEccccHHHHcccGGGcTTTccEEcEEETTEEEccccccTHHHHHHHHTcccccGGGTTEccccccccEEEEEEEEEcccccHHHHHHHHHHHHHHTcccHHHHHHTTcccccHHHHHHHHHHHTcT# DISOP:02AL 1-4,28-54| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccEEEEEEEccHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHccccEEcccccccHHHHHHHHHHccccccEEEEEEEcEEEEEEcccccccccccHHHHHHHHccccccccHHHHHHcccccccccccEEEEEccccccHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHcccccEEEEEHHHHHHHcccEEEEEcccccEEccHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEccHHHHHHHHHHHHHcc //