[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55503.1
DDBJ      :             hypothetical protein
Swiss-Prot:PURQ_CORGL   RecName: Full=Phosphoribosylformylglycinamidine synthase 1;         EC=6.3.5.3;AltName: Full=Phosphoribosylformylglycinamidine synthase I;         Short=FGAM synthase I;

Homologs  Archaea  59/68 : Bacteria  791/915 : Eukaryota  78/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:223 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->216 3d54D PDBj 1e-36 42.9 %
:RPS:PDB   1->218 3d54D PDBj 2e-26 38.6 %
:RPS:SCOP  4->218 1t3tA2  c.23.16.1 * 7e-21 25.6 %
:HMM:SCOP  3->222 1t3tA2 c.23.16.1 * 5e-65 49.5 %
:RPS:PFM   37->96 PF07685 * GATase_3 4e-09 54.4 %
:HMM:PFM   21->112 PF00117 * GATase 7.4e-11 29.6 71/192  
:BLT:SWISS 1->223 PURQ_CORGL e-121 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55503.1 GT:GENE BAF55503.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2751302..2751973) GB:FROM 2751302 GB:TO 2751973 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55503.1 LENGTH 223 SQ:AASEQ MSAKIGVITFPGTLDDVDAARAARIAGAEVISLWHADEDLKGVDAVVVPGGFSYGDYLRTGAISALAPVMQSVIEQAGKGMPVLGICNGFQILTEARLLPGALTRNKGLHFHCVDAHLVVENNTTAWTNTLEKGQQILIPAKHGEGRFQADAETIAQLEGEGRVVFRYTDNFNGSVNDIAGITNETGRIVGLMPHPEHAVEKLTGPSIDGLELFLSAVGTIAA GT:EXON 1|1-223:0| SW:ID PURQ_CORGL SW:DE RecName: Full=Phosphoribosylformylglycinamidine synthase 1; EC=6.3.5.3;AltName: Full=Phosphoribosylformylglycinamidine synthase I; Short=FGAM synthase I; SW:GN Name=purQ; OrderedLocusNames=Cgl2589, cg2863; SW:KW ATP-binding; Complete proteome; Cytoplasm; Glutamine amidotransferase;Ligase; Nucleotide-binding; Purine biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->223|PURQ_CORGL|e-121|100.0|223/223| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006541|"GO:glutamine metabolic process"|Glutamine amidotransferase| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006164|"GO:purine nucleotide biosynthetic process"|Purine biosynthesis| SEG 19->28|aaraariaga| BL:PDB:NREP 1 BL:PDB:REP 1->216|3d54D|1e-36|42.9|205/211| RP:PDB:NREP 1 RP:PDB:REP 1->218|3d54D|2e-26|38.6|207/211| RP:PFM:NREP 1 RP:PFM:REP 37->96|PF07685|4e-09|54.4|57/151|GATase_3| HM:PFM:NREP 1 HM:PFM:REP 21->112|PF00117|7.4e-11|29.6|71/192|GATase| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF07685|IPR011698| GO:PFM GO:0009236|"GO:cobalamin biosynthetic process"|PF07685|IPR011698| RP:SCP:NREP 1 RP:SCP:REP 4->218|1t3tA2|7e-21|25.6|215/262|c.23.16.1| HM:SCP:REP 3->222|1t3tA2|5e-65|49.5|218/0|c.23.16.1|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 942 OP:NHOMOORG 928 OP:PATTERN --11--1-11111111-111111111111111111111111111111111111111111-1111--11 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111--1--111---1-----1--1----------------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111-1-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-1111111111-1111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111---------------111111111111111111111111111111111111111111111111-1--11-111111---111-1111111----111111-1111-111111111111111111111111111111111-1-------11111111111111111111111111111111111111-11111------11111111111111111-1111111111111-111111111111111111111111111111111111111111111111111--1111111111111111111111-111111111111111111111111111111111111111111111111111111111111111111111111111-111111111--------1---------------------------1-11111111111 ------------11111-11111111---1111-------------111111111111-111111-11-11111111-11111111-1-1-111-21---1-1111-1----------------------------------------------------------13-11--------9111----1-11---1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 223 STR:RPRED 100.0 SQ:SECSTR cccEEEEEccTTEEEHHHHHHHHHTTTcEEEEEEcTTcccccccEEEEcEEcGGGGcccTTHHHHTcTTHHHHHHHHHHTcEEEEcHHHHHHHHHTcccccEEEccccccccccEEEEEEcccccTTcTTccTTcEEEEEccccccEEEcccEEEEEcccccEEEEEEcccccccGGGEEEEEcccccEEEEccccTTTTcTTTTcccTTcHHHHHHHHHHHH DISOP:02AL 1-1| PSIPRED cccEEEEEEEcccccHHHHHHHHHHccccEEEEEEccccHHHccEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccEEEEEHHHHHHHHcccccccEEEcccccEEccEEEEEEEccccHHHcccccccEEEEEEEEccccEEEcHHHHHHHHHcccEEEEcccccccccccEEEEEcccccEEEEcccHHHHccHHHccccccHHHHHHHHHHHcc //