[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55504.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  161/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.284.1
:81 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->72 1twjC PDBj 4e-12 48.6 %
:RPS:PDB   1->74 3d54B PDBj 1e-22 29.7 %
:RPS:SCOP  1->74 1vq3A  d.284.1.1 * 8e-22 29.7 %
:HMM:SCOP  1->78 1t4aA_ d.284.1.1 * 1.7e-20 50.0 %
:RPS:PFM   3->74 PF02700 * PurS 1e-10 50.0 %
:HMM:PFM   4->74 PF02700 * PurS 4.5e-26 47.9 71/80  
:BLT:SWISS 1->74 Y221A_MYCLE 3e-25 68.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55504.1 GT:GENE BAF55504.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2751970..2752215) GB:FROM 2751970 GB:TO 2752215 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55504.1 LENGTH 81 SQ:AASEQ MARVVVNVMPKAEILDPQGQAVHRALGRIGVSGVSDVRQGKRFELEVDDSVTEADLKKIAETLLANTVIEDFDVVGVEVAK GT:EXON 1|1-81:0| BL:SWS:NREP 1 BL:SWS:REP 1->74|Y221A_MYCLE|3e-25|68.9|74/79| BL:PDB:NREP 1 BL:PDB:REP 1->72|1twjC|4e-12|48.6|72/79| RP:PDB:NREP 1 RP:PDB:REP 1->74|3d54B|1e-22|29.7|74/82| RP:PFM:NREP 1 RP:PFM:REP 3->74|PF02700|1e-10|50.0|72/79|PurS| HM:PFM:NREP 1 HM:PFM:REP 4->74|PF02700|4.5e-26|47.9|71/80|PurS| GO:PFM:NREP 1 GO:PFM GO:0016879|"GO:ligase activity, forming carbon-nitrogen bonds"|PF02700|IPR003850| RP:SCP:NREP 1 RP:SCP:REP 1->74|1vq3A|8e-22|29.7|74/86|d.284.1.1| HM:SCP:REP 1->78|1t4aA_|1.7e-20|50.0|78/80|d.284.1.1|1/1|PurS-like| OP:NHOMO 163 OP:NHOMOORG 162 OP:PATTERN -----------------------------------------------------1-------------- 1-1-11-111111111111-11111111111111111111111111111111111111--11111111111----------------------------------1---------------------------------------------------------------------------------------1111111111111111--1111111---1-11------11-------------------------------------1-------------------------------------------------------------------------------------------------------------111-11------------11111111111-1111111--111-2--1---111-1111-11111--111------------111-------------------------------111-1-----------------------------------------------------------------------------------------------1-11----1111111111----------1--11----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 97.5 SQ:SECSTR EEEEEEEEEEcTTcccHHHHHHHHHHHHTcccccccccccEEEEEEEEccHHHHHHHHHHHHTTccTTTEEEEEEEEEE## DISOP:02AL 81-82| PSIPRED cEEEEEEEEEccccccHHHHHHHHHHHHcccccHHHEEEEEEEEEEEccccHHHHHHHHHHHHcccccEEEEEEEEEEEcc //