[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55512.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:38 amino acids
:PSIPRED
:DISOPRED
:REPEAT 2|1->18|19->36

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55512.1 GT:GENE BAF55512.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2762041..2762157) GB:FROM 2762041 GB:TO 2762157 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55512.1 LENGTH 38 SQ:AASEQ MDSVFAIFQAIFDGVEGLINSVIGGAQGVFDSIKNFSS GT:EXON 1|1-38:0| NREPEAT 1 REPEAT 2|1->18|19->36| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,37-39| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //