[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55547.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  529/915 : Eukaryota  8/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:230 amino acids
:PSIPRED
:BLT:PDB   3->218 2nq2C PDBj 2e-13 23.6 %
:RPS:PDB   9->191 2dwpA PDBj 9e-16 5.6 %
:RPS:SCOP  1->214 1l7vC  c.37.1.12 * 9e-15 17.4 %
:HMM:SCOP  12->196 1ii8.1 c.37.1.12 * 2e-43 37.2 %
:HMM:PFM   38->146 PF00005 * ABC_tran 6.3e-17 38.2 102/118  
:HMM:PFM   8->47 PF00931 * NB-ARC 8e-05 27.5 40/285  
:BLT:SWISS 12->219 MNTB_BACSU 3e-16 27.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55547.1 GT:GENE BAF55547.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2801961..2802653 GB:FROM 2801961 GB:TO 2802653 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55547.1 LENGTH 230 SQ:AASEQ MLLTFTDAAVDPLWKDLNLELRQGEFLAVLGPNGVGKSTLIGTILGTRKLTHGSVKTDARVGYIPQQRIFDVPLRARDMVSLSAAHGVVSKRGPAKGDVDKLLARVGASGIADRRVGELSGGQQQLVRQAQALATRPQLLLADEPLLSLDPGVAQRTVSLFGELKAEGVGVVVVTHDVNPLMGLVDRILYLAPNGHTIGTVGDVMQSEKLSELYNAPVTVARINDRIVVV GT:EXON 1|1-230:0| BL:SWS:NREP 1 BL:SWS:REP 12->219|MNTB_BACSU|3e-16|27.4|208/250| SEG 123->134|qqqlvrqaqala| SEG 139->151|llladepllsldp| SEG 168->174|gvgvvvv| BL:PDB:NREP 1 BL:PDB:REP 3->218|2nq2C|2e-13|23.6|216/251| RP:PDB:NREP 1 RP:PDB:REP 9->191|2dwpA|9e-16|5.6|179/431| HM:PFM:NREP 2 HM:PFM:REP 38->146|PF00005|6.3e-17|38.2|102/118|ABC_tran| HM:PFM:REP 8->47|PF00931|8e-05|27.5|40/285|NB-ARC| RP:SCP:NREP 1 RP:SCP:REP 1->214|1l7vC|9e-15|17.4|213/231|c.37.1.12| HM:SCP:REP 12->196|1ii8.1|2e-43|37.2|183/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 953 OP:NHOMOORG 571 OP:PATTERN ---1-----------11--1-1231113-1141-1--------114231221--1122211-----12 --1-5522333421112----11123-----121112253133211--11112212-1--2--34322221-111212--112-1-11--1--1--1---1-----1-2-1111111-111111112-111112-133323---31-22-22-22---11----113---2-111----111-2111111-11-4444412323221212222212322-121111----1121---------------11-1-11133111111112431-1111----------211-11-111-1-1-------------222--1222-111--1111121-1-1-111---1-1-13--116511-111-121-1-311-11--1-------2221121122222222222222-12-1221311-2133232353523211113122131223111111111----121-----------------------------11-1--243232223222----22411111113232121--22231111121-311-111112----------111---3--11--------121--11-1----1-23-14----11-----------11-1111111-211--1-1--------11---1--1--------------1-33-112333233322-222233323223322222233312123122222222222222232223332--322222222222--1------------1-1222-1-1-1--1111-------1112-1--1-1111---12112---------22121-----1-1--1-----------------11------------1--111----------------------11111---2-1-1 ------------1-------------------------------------------------------------------------------------------------1-----------------------------------------------1------1----2--11-------------------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEcccccEEEEcccEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEEEEcccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHccccHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHccEEEEEcccccccccccEEEEEccHHHHHHccccEEEEccEEEEc //