[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55552.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:173 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55552.1 GT:GENE BAF55552.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2807228..2807749 GB:FROM 2807228 GB:TO 2807749 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55552.1 LENGTH 173 SQ:AASEQ MRRIEFDGDWLLTKHVHSGGSSGEDHCFVGWMWGAYCDDVHPGGEDLIDRREAGRNSIFRCGFRCFHTIHITDCADFRAGDCLNCFDVVSADCTATDNADFPDLVGHYFFPRSSSLVKAVSLVVKITAADSAIAPMMNPATASQPFHAYRAVAMVGAKPTMIRPSWLPIAMPV GT:EXON 1|1-173:0| SEG 113->125|ssslvkavslvvk| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1| PSIPRED ccEEEEcccEEEEEHHHcccccccccEEEEEHHHHHHccccccHHHHHHHHHHcccHHHHEEEEEEEEEEEEccccccccccccHHHHHccccccccccccHHHHHHHcccccHHHHHHHEEEEEEEEcccccccccccccccccHHHHHHHHHHcccccEEcccccEEEccc //