[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55556.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  882/915 : Eukaryota  117/199 : Viruses  0/175   --->[See Alignment]
c.116.1d.79.3
:313 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   99->309 1gz0H PDBj 1e-33 41.8 %
:RPS:PDB   163->313 3e5yA PDBj 2e-30 19.9 %
:RPS:SCOP  69->142 1gz0A2  d.79.3.3 * 7e-08 24.7 %
:RPS:SCOP  143->309 1gz0A1  c.116.1.1 * 7e-43 43.6 %
:HMM:SCOP  57->143 1gz0F2 d.79.3.3 * 3.1e-16 36.0 %
:HMM:SCOP  134->313 1v2xA_ c.116.1.1 * 2.6e-45 35.1 %
:RPS:PFM   70->144 PF08032 * SpoU_sub_bind 1e-06 40.3 %
:RPS:PFM   163->302 PF00588 * SpoU_methylase 5e-23 38.6 %
:HMM:PFM   163->302 PF00588 * SpoU_methylase 1.3e-37 33.1 139/142  
:HMM:PFM   70->145 PF08032 * SpoU_sub_bind 1.1e-18 34.7 75/76  
:BLT:SWISS 1->310 Y572_MYCA9 1e-96 58.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55556.1 GT:GENE BAF55556.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2809863..2810804) GB:FROM 2809863 GB:TO 2810804 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55556.1 LENGTH 313 SQ:AASEQ MAGNDSRRGGLRKTNKKGATKGSGGQVRRGLKGKGPTPKAEDRTYHAAHKRKLERERRDRGRHQREMPELVVGRNPVLECLHARVPATALYVAEGAANDERLSEAVHTAAGRNIPVLEVNKLELDRMTGNGMHQGIGLAIPPYEYADVHDLIANAATSKKPGMFVILDNITDPRNLGAVIRSVGAFGGNGVIIPERRSASVTAVAWRTSAGTAARVPVAKETNMTRVVKEFQQNGYQVVGLDAGGDHTLDTYDGTDNVVIVVGSEGKGISRLVRENCDTIMSIPTEGWVESLNASVAAGVVLSEFSRQRRIKG GT:EXON 1|1-313:0| BL:SWS:NREP 1 BL:SWS:REP 1->310|Y572_MYCA9|1e-96|58.7|310/315| SEG 51->66|rklererrdrgrhqre| BL:PDB:NREP 1 BL:PDB:REP 99->309|1gz0H|1e-33|41.8|201/242| RP:PDB:NREP 1 RP:PDB:REP 163->313|3e5yA|2e-30|19.9|151/156| RP:PFM:NREP 2 RP:PFM:REP 70->144|PF08032|1e-06|40.3|72/77|SpoU_sub_bind| RP:PFM:REP 163->302|PF00588|5e-23|38.6|140/143|SpoU_methylase| HM:PFM:NREP 2 HM:PFM:REP 163->302|PF00588|1.3e-37|33.1|139/142|SpoU_methylase| HM:PFM:REP 70->145|PF08032|1.1e-18|34.7|75/76|SpoU_sub_bind| GO:PFM:NREP 4 GO:PFM GO:0008168|"GO:methyltransferase activity"|PF08032|IPR013123| GO:PFM GO:0003723|"GO:RNA binding"|PF00588|IPR001537| GO:PFM GO:0006396|"GO:RNA processing"|PF00588|IPR001537| GO:PFM GO:0008173|"GO:RNA methyltransferase activity"|PF00588|IPR001537| RP:SCP:NREP 2 RP:SCP:REP 69->142|1gz0A2|7e-08|24.7|73/76|d.79.3.3| RP:SCP:REP 143->309|1gz0A1|7e-43|43.6|163/166|c.116.1.1| HM:SCP:REP 57->143|1gz0F2|3.1e-16|36.0|86/87|d.79.3.3|1/1|L30e-like| HM:SCP:REP 134->313|1v2xA_|2.6e-45|35.1|171/191|c.116.1.1|1/1|alpha/beta knot| OP:NHOMO 1707 OP:NHOMOORG 1000 OP:PATTERN -----------------------1-------------------------------------------- 2222323223332332333-332222333332211132321111223233332321221112132332312111111122221211112221322321112322232223--------------24423334233433332---4332222222222222221222222232222222222223221121132222222222222222212111222232221232222222222222222222222221122222322312221133222222221222222222211222212222122222222222222222222222222122222222222221222222222221221233222222222222111121333233223111111111111133332333332-1111111123113332223222332212111111111111111111111111231111111111111111111111111111111111111111111111122222112222222211211111111111111111111111122211-1111112111212121122222222-2111111111111112111111111111111111111121114112211231212331111112111121221211-11211------33333323333333232-3333333333333333333222332233323333333333333333333332133333333332211121111111112211111111111111111211111111111211111111111111111111-11-111122211111322322211121111111111113311111111111122211212-21212211111211111111111111111-21 ----12----1-11111--1111111-11----11111-11111--11111111--111111--1--1--111--11--11---11-1----1----------111--4-3-1231----111211-2-121-1-2-11-11111-11--1--1-11--221-2-2-----11121111A332112--4-21313111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 240 STR:RPRED 76.7 SQ:SECSTR #####################################################################EEccHHHHHHHHTTTcEEEEEE###EEcccTTHHHHHHHHHHHTcEEEEEcHHHHHHHcTTcccTTEEEEEccccGGGHHHHHH#EcccEEcTcEEEEEccccHHHHHHHHHHHHHHTcEEEEEccccccccHHHHHHTTccHHHHHTcEEEccHHHHHHHHcccGGGEEEEccTTcEEGGGccccTTcEEEEEcTTTcccHHTTccGGGEEEcccccccccccHHHHHHHHHHHHHHHTTTTT DISOP:02AL 1-67,313-314| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccHHHcccEEEEEEHHHHHHHHHccccEEEEEEEccccccHHHHHHHHHHHHcccEEEEEcHHHHHHHHcccccHHEEEEEcccccccHHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHHHcccEEEEcccccccccHHHHHHHccHHHHccEEEEccHHHHHHHHHHcccEEEEEcccccccHHHccccccEEEEEccccccccHHHHHHcccEEEEcccccccHHHHHHHHHHHHHHHHHHHHccc //