[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55561.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  548/915 : Eukaryota  128/199 : Viruses  0/175   --->[See Alignment]
c.1.9
:388 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   22->360 2vhlB PDBj 1e-30 33.4 %
:RPS:PDB   20->387 3egjA PDBj 9e-23 21.9 %
:RPS:SCOP  64->358 1o12A2  c.1.9.10 * 2e-64 34.3 %
:HMM:SCOP  64->358 1yrrA2 c.1.9.10 * 7.2e-69 40.8 %
:HMM:PFM   60->373 PF01979 * Amidohydro_1 1.9e-13 20.7 295/328  
:BLT:SWISS 21->71 MTAD1_ARCFU 4e-05 29.4 %
:BLT:SWISS 61->380 NAGA_BACSH 1e-31 36.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55561.1 GT:GENE BAF55561.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2816518..2817684) GB:FROM 2816518 GB:TO 2817684 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55561.1 LENGTH 388 SQ:AASEQ MAEVVHYQENAGQAVKKIEGRIVTPHGVIDGFLQLENGIITELSGEPAPKNAGFHPELPTIVPGFIDLHNHGGNGGAFPTGTQDQARNAAQYHREHGTTVMLASMVSAPADALAAQVENLIPLCEEGLLCGIHLEGPFINACRCGAQNPDFIFPGNPTDLAQVIHAGKGWIKSITVAPETDNLSELLDLCAAHHIIASFGHTDADFDTTTSAIALAKEKNVTVTATHLFNAMPPLHHRAPGSVGALLAAARAGDAYVELIADGVHLADGTVDLARSNNAFFITDAMEAAGMPDGEYILGVLNVTVTDGVARLRDGGAIAGGTSTLASQFVHHVRRGMTLIDATLHTSTVAAKILGLSDHEIAKSNPVNFVVFDSNGQLQQVHLDHQVI GT:EXON 1|1-388:0| BL:SWS:NREP 2 BL:SWS:REP 21->71|MTAD1_ARCFU|4e-05|29.4|51/422| BL:SWS:REP 61->380|NAGA_BACSH|1e-31|36.3|306/387| SEG 244->255|gallaaaragda| BL:PDB:NREP 1 BL:PDB:REP 22->360|2vhlB|1e-30|33.4|329/393| RP:PDB:NREP 1 RP:PDB:REP 20->387|3egjA|9e-23|21.9|361/379| HM:PFM:NREP 1 HM:PFM:REP 60->373|PF01979|1.9e-13|20.7|295/328|Amidohydro_1| RP:SCP:NREP 1 RP:SCP:REP 64->358|1o12A2|2e-64|34.3|277/288|c.1.9.10| HM:SCP:REP 64->358|1yrrA2|7.2e-69|40.8|284/0|c.1.9.10|1/1|Metallo-dependent hydrolases| OP:NHOMO 820 OP:NHOMOORG 689 OP:PATTERN ----1---1111111111---------------------------------------1---1------ 111-211-111-1-11111-1---11111111-----2111--122111--1123-11--111111111111---111111-1-----2232-3-------1---1-2-4----------------------------------111111111--111111111-111111-111---1-11-1111-1111-1111111221121112111111111111211122222111-11111111111111111112111121-11111--221121111111111111111111111111111111111111111111111111111-111111111212-2--11111-11-311--------11--1111211-11122-------------------11111111111-1-11-1--11--111111111111------11--1-111111111111111--1--------------------------------1--1-----111111111111111111111111--1------1-----------------1----------------------------------------------------------------------1--2111-11-1-1211111-122211121111-------------21112111222222222-2222222222222221222111111121211111111111111111111111-12222222222211-------------1-1111111111111111-----------111111111---------111111111-1334222221113322111111111111---1------11111111-----------1-1----1-11-1----11111111111-1 ------1-1------2-22121111111111111111111-1111112111121111--111111----1--1-1------11111---121-11-2111--1211-1--1111111111--111113-3A1-21111-111111-11--11-11111111-1-11-11111111----------1---2---11---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 383 STR:RPRED 98.7 SQ:SECSTR #####EEEEcccHHHHTcccEEEccccEEcEEEEEETTEEEEEEEGGGccTTccEEEcTTEEEcEEEEEEcccTTccTTTccHHHHHHHHHHHHTTTEEEEEEEEEcccHHHHHHHHHHHHHHHHHcccccEEEEcccccGGGcTTccTTTcccEccHHHHHHHHHTGGGEEEEEEcGGGccHHHHHHHHHHTTcEEEEccccccHHHHHHHHHHHHHHHTccEEccTTcccccccTTccHHHHHHHTcTTcEEEEccccccccHHHHHHHHHHHGGGEEEcccccTTTTccccEEEETTEEEEEETTEEEETTTEEccccccHHHHHHHHHHTTcccHHHHHHTTTHHHHHHHTcTTTcccTTccccEEEEcTTccEEEEEETTEEE DISOP:02AL 1-1,4-7| PSIPRED ccHHHcccccccccEEEEEEEEEccccEEEEEEEEEccEEEEEcccccccccEEEccccEEEEEEEEcccccccccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHHHccccccEEEccccccHHHHccccHHHHccccHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHcccEEEEEccccccccccccccHHHHHHcccccccEEEEEEEccEEccHHHHHHHHHccEEEEcccccccccccccEEccccEEEEEccEEEEccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccccccEEEEcccccEEEEEEccEEc //