[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55565.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:74 amino acids
:PSIPRED
:DISOPRED
:REPEAT 2|1->16|25->36

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55565.1 GT:GENE BAF55565.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2820556..2820780 GB:FROM 2820556 GB:TO 2820780 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55565.1 LENGTH 74 SQ:AASEQ MWWIFASHLPKSARIYHRFQDSSGMWWILALLTPSNHTGITPASVAPKTTVPESLLRAQRRQNQTRGHPTRKGP GT:EXON 1|1-74:0| NREPEAT 1 REPEAT 2|1->16|25->36| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ---------11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 6-7,57-75| PSIPRED cEEEEcccccccEEEEEEEEccccHHEHHHHHccccccccccccccccccccHHHHHHHHHHHHHccccccccc //