[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55574.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:125 amino acids
:PSIPRED
:DISOPRED
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55574.1 GT:GENE BAF55574.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2829897..2830274) GB:FROM 2829897 GB:TO 2830274 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55574.1 LENGTH 125 SQ:AASEQ MYGRGMPKLSSPKVWNLVAIIVLGGMATEQILGFRDNNPTALVMWISSAIAIGAVAWGLSNYKKPCNWFIPRLYAFAAVPNLMLFFDAQSWTKFWGGLAGAVIFTLILSGFLAPYKDFHKSPKRK GT:EXON 1|1-125:0| TM:NTM 4 TM:REGION 12->34| TM:REGION 40->62| TM:REGION 66->88| TM:REGION 94->116| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,118-126| PSIPRED cccccccccccccHHHHHHHHHHcccHHHHHHEEccccccEEEEHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHcccEEEEEEccHHHHHHcHHHHHHHHHHHHHHHcccHHHHHHccccc //