[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55578.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  5/68 : Bacteria  846/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
a.4.6c.23.1
:241 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   16->238 2oqrA PDBj 9e-43 40.3 %
:RPS:PDB   15->236 3c3wB PDBj 5e-27 18.1 %
:RPS:SCOP  15->130 1a0oA  c.23.1.1 * 7e-20 23.3 %
:RPS:SCOP  143->239 1oddA  a.4.6.1 * 3e-23 29.9 %
:HMM:SCOP  13->204 1s8nA_ c.23.1.1 * 2.2e-39 29.9 %
:RPS:PFM   16->125 PF00072 * Response_reg 4e-12 34.5 %
:RPS:PFM   162->238 PF00486 * Trans_reg_C 3e-15 46.8 %
:HMM:PFM   16->124 PF00072 * Response_reg 9.6e-30 37.6 109/112  
:HMM:PFM   165->238 PF00486 * Trans_reg_C 6.3e-27 45.9 74/77  
:BLT:SWISS 16->238 REGX3_MYCTU 3e-42 40.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55578.1 GT:GENE BAF55578.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2832499..2833224 GB:FROM 2832499 GB:TO 2833224 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55578.1 LENGTH 241 SQ:AASEQ MTNPSPALNETLSGRVLIVEDERPLARMISLYLSKAGFDTTTIHDGAAAPDKVAHLRPDVVILDLGLPGLDGLEVCKRIRAFTDCYILMLTARGSERDRITGLEIGADDYITKPFNIRELVIRIQSVMRRPRKIDETIQNGLTLTYGHIELDTLAHEVTVKGVGVTLTRTEFELLQALMHKPGEAVSRRDLVSQVWDTTWVGDERIVDVHIGNLRRKLEAPAPGSHFIDTIRGVGYRMAFK GT:EXON 1|1-241:0| BL:SWS:NREP 1 BL:SWS:REP 16->238|REGX3_MYCTU|3e-42|40.3|221/227| SEG 59->75|dvvildlglpgldglev| BL:PDB:NREP 1 BL:PDB:REP 16->238|2oqrA|9e-43|40.3|221/226| RP:PDB:NREP 1 RP:PDB:REP 15->236|3c3wB|5e-27|18.1|204/210| RP:PFM:NREP 2 RP:PFM:REP 16->125|PF00072|4e-12|34.5|110/111|Response_reg| RP:PFM:REP 162->238|PF00486|3e-15|46.8|77/77|Trans_reg_C| HM:PFM:NREP 2 HM:PFM:REP 16->124|PF00072|9.6e-30|37.6|109/112|Response_reg| HM:PFM:REP 165->238|PF00486|6.3e-27|45.9|74/77|Trans_reg_C| GO:PFM:NREP 7 GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00072|IPR001789| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00072|IPR001789| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00072|IPR001789| GO:PFM GO:0000156|"GO:two-component response regulator activity"|PF00486|IPR001867| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF00486|IPR001867| GO:PFM GO:0003677|"GO:DNA binding"|PF00486|IPR001867| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00486|IPR001867| RP:SCP:NREP 2 RP:SCP:REP 15->130|1a0oA|7e-20|23.3|116/128|c.23.1.1| RP:SCP:REP 143->239|1oddA|3e-23|29.9|97/100|a.4.6.1| HM:SCP:REP 13->204|1s8nA_|2.2e-39|29.9|184/190|c.23.1.1|1/1|CheY-like| OP:NHOMO 9283 OP:NHOMOORG 860 OP:PATTERN -----------------------------------------------1-1111--------------- 7BF7R466778655CCCAA-AG44ABAAAAA9GEGGAGHG9CBFAA687997BDG45711KIN6P6IPOQ7444465547JB7133666684-822---22B455H4D8B--------------132322226231HGGJIH8DO5PGNFGF8AC9A867A89AB9BOLS7584665574654DD65534-A5GTTUTURTUHUSWWUQFGDBBCTVb8ACT8ECA99A9AcW7AA9A99899AAA9969996B675CC655466677CC655675686CEC866889988888898888555556666665587655476775RILZPPPUSUVQRKEdUU9DEBQKE8BAGM83bVF89434546586228B64DCCB56556DBLIIE9CCJEGI9989999988B-BDDBFJFFAL91MKKKHEIMMHECDM8A8B9FD9DCAAAAAAAAAAACAB89GE81111111111222233232222222212236BE56BFEBDNQTRVNJHHHDNNOPJHJIBJVLPJMMU12HLOJ9IDBSHCGL5ELF6667971211111752CGJ8A744231474223-C9A8999866565CE26944643333342224222227747B66FD8BDBL7DD8IEJJGAIFHGGIIIGIKKI--23535------DEDFCFAEFFFEFFGEE-FGFEEEEEEGFEEEEEEEDHFGCF888DCDDDDDDCDDCDCDDFDCDDDEE81CDDDDDDDDDDD--2A3333345448AJAJ444333244443125BA89B6A77AE9MLNMMTTSEPSSQGJJM3212132123BCCLDDDDDGHKFGMNC8E89CCC5545--91444455--------2-2-------------------------37433454444B3 --------------1-----------------------------------------------------------------------------------------------------------------------------------------------1----2-1-------1-1---------2--9-----7---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 239 STR:RPRED 99.2 SQ:SECSTR ccccTTc#cEEcccEEEEEcccHHHHHHHHHHHHTcTTEEEEEEcHHHHHHHHHHHcccEEEEccEETTEEHHHHHHHHHHHcTcEEEEGGGcccHHHHHHHHHHTcccHHHHHHHHHHHHHHHHHHHHHGGGccHHHHHHHcEEETTEEHHHHHHHHHHccTTTTccHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHTccHHHHHHHHHHHHHHTTccTcccHHHHHHHHHTcEEcc# DISOP:02AL 1-10,131-143| PSIPRED cccccccccccccccEEEEEccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHcccccEEEEEccccHHHHHHHHHcccccEEcccccHHHHHHHHHHHHHHccccccccccccEEEEccEEEEcccEEEEEccEEEEccHHHHHHHHHHHHcccccccHHHHHHHHccccccccccEEHHHHHHHHHHcccccccccEEEEEccccEEEEEc //