[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55583.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  35/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:229 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   25->143 PF06525 * SoxE 3.4e-07 21.4 98/195  
:HMM:PFM   8->38 PF06072 * Herpes_US9 0.00071 22.6 31/60  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55583.1 GT:GENE BAF55583.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2837723..2838412) GB:FROM 2837723 GB:TO 2838412 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55583.1 LENGTH 229 SQ:AASEQ MFCVGTSRHDEVIYKRRRMAALLVLLVVIALIIWAVVALRGGSSEPEQEQPTNAVVTSSMESSTTSSSSSKETTTEATTEEETSSAEPTATSTVAADAKKTCELSDLVISASTNQPTFSGSAQPELFMTVHNPTAVDCEIDLEENKLRFEVYNLATNARIWSDVDCNPAVEDGTSVFPAGEDRYFQATWSRTTSAPNQCNNRTDVPAGGYYLHTVVGNNPSPAVTFNLT GT:EXON 1|1-229:0| TM:NTM 1 TM:REGION 20->40| SEG 20->39|aallvllvvialiiwavval| SEG 57->93|tssmessttssssskettteatteeetssaeptatst| HM:PFM:NREP 2 HM:PFM:REP 25->143|PF06525|3.4e-07|21.4|98/195|SoxE| HM:PFM:REP 8->38|PF06072|0.00071|22.6|31/60|Herpes_US9| OP:NHOMO 35 OP:NHOMOORG 35 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11111111111111111111-----------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,4-4,6-6,42-100,194-204| PSIPRED cEEEEcccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHEEEEEEccccccccccccEEEEEEEEcccccEEEEccccEEEEEEEEcccccEEEEccccccccccEEEEEccccEEEEEEEEccccccccccccccccccccEEEEEEEcccccccccEEEc //