[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55587.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:385 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   13->41 PF08105 * Antimicrobial10 0.00011 41.4 29/52  
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55587.1 GT:GENE BAF55587.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2841918..2843075 GB:FROM 2841918 GB:TO 2843075 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55587.1 LENGTH 385 SQ:AASEQ MLGLSRRKFAMLAALTAGVVGVVATGCSTLAEPETIDNPVFIGISIDPIKNLSPNHAANLFALSADGSGGIFQELAPTYFPSIHRLGNGFIAPDRDSLVVVDASLKEVYRHEMARLGVGMQTQSARSPLHKSVAFSFNEGTAEAPYRHRIVSATEKTSASAMTDQRHFALTACDDGSTRWVEYFPDRGMEDPMGPGSARIVTLQADGELSEIDVEWNFPDRPSAPIILSCEDPSAYIVSEEDIIYVKDEVSPAESIGKLRAYETPDRARFDTVSGEDYFAFTSTGMLTRINIPQAKIVYAQSIDLYGKHPVSITFDSDRAYVVTSGDSGESLLEIDLNDPTCTSDQLSLTGFNQLLTARKPKPEPSIIIETILPIDPNYSLGCKS GT:EXON 1|1-385:0| SEG 12->26|laaltagvvgvvatg| HM:PFM:NREP 1 HM:PFM:REP 13->41|PF08105|0.00011|41.4|29/52|Antimicrobial10| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6,159-161,384-386| PSIPRED cccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEcccccccccccccEEEEEccccccHHHHHccHHHHHHHHccccccccccccEEEEEHHHHHHHHHHHHHHccccccccccccccEEEEEEEcccccccccEEEEEEccccccHHHcccccEEEEEEEccccEEEEEEccccccccccccccEEEEEEEccccEEEEEEEEcccccccccEEEEEccccEEEEccccEEEEEccccHHHHHcccccccccccccccccccccEEEEEccccEEEEccccEEEEEEEEEcccccccEEEEEccccEEEEEccccccEEEEEEcccccccccEEEEEcHHHHHHcccccccccEEEEEEEEccccccccccc //