[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55591.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.136.1
:247 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  1->49 1q32A1  d.136.1.3 * 4e-04 20.4 %
:HMM:PFM   57->106 PF08428 * Rib 8.8e-05 42.9 35/65  
:REPEAT 2|21->103|116->202

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55591.1 GT:GENE BAF55591.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2844839..2845582 GB:FROM 2844839 GB:TO 2845582 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55591.1 LENGTH 247 SQ:AASEQ MVAEYPDGSSEIFPVTLNLIPEDTHVYDAVYKFKSIRTGSEDQITPFASNQPDVSFPAGTSFTLTGYYEIDQLRSAGWKFELNPVTGELSVTVPISVIYPDGSRDNTIATMESVGPDDSELFKPDFDLIPIKSGDYIEIGVLAPGLPAGTEFHLDYYTLPSRFFALGGSINLSGNGKFSLEVPLTWNDDLPLPISIIFPDGSSTVENLHVDVTPANFAGNPIDEPKDDDKDHPQPAPKPSGSSFGSS GT:EXON 1|1-247:0| NREPEAT 1 REPEAT 2|21->103|116->202| HM:PFM:NREP 1 HM:PFM:REP 57->106|PF08428|8.8e-05|42.9|35/65|Rib| RP:SCP:NREP 1 RP:SCP:REP 1->49|1q32A1|4e-04|20.4|49/208|d.136.1.3| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- --------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7,224-248| PSIPRED ccccccccccEEEEEEEEEccccccHHHHHHEEcccccccccccccccccccccccccccEEEEEEEEEEHHHHccccEEEEccccEEEEEEEEEEEEEcccccccEEEEEHHccccHHHHccccccEEEEccccEEEEEEEccccccccEEEEEEEEccHHHHHccccEEEccccEEEEEEEEEEccccccEEEEEEccccccEEEEEEEEEcHHccccccccccccccccccccccccccccccc //