[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55593.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:97 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->69 1iujB PDBj 2e-07 31.3 %
:RPS:PDB   2->66 3e8oA PDBj 1e-08 10.9 %
:RPS:SCOP  1->66 1lq9A  d.58.4.3 * 1e-09 15.4 %
:HMM:SCOP  1->93 1sqeA_ d.58.4.5 * 1.4e-16 32.6 %
:HMM:PFM   3->69 PF03992 * ABM 1.9e-15 25.4 67/78  
:BLT:SWISS 30->88 ISDG_BACHK 6e-05 37.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55593.1 GT:GENE BAF55593.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2845775..2846068) GB:FROM 2845775 GB:TO 2846068 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55593.1 LENGTH 97 SQ:AASEQ MSFVNITALTFPAGAEKEIEQRFAARKKAVDTAKGFQEFELLRPQFGEDRYFVVTRWDSREDYQAWSDARPAGNHADDEQRGMSVEVLGFDVVPLEG GT:EXON 1|1-97:0| BL:SWS:NREP 1 BL:SWS:REP 30->88|ISDG_BACHK|6e-05|37.9|58/107| BL:PDB:NREP 1 BL:PDB:REP 3->69|1iujB|2e-07|31.3|67/103| RP:PDB:NREP 1 RP:PDB:REP 2->66|3e8oA|1e-08|10.9|64/99| HM:PFM:NREP 1 HM:PFM:REP 3->69|PF03992|1.9e-15|25.4|67/78|ABM| RP:SCP:NREP 1 RP:SCP:REP 1->66|1lq9A|1e-09|15.4|65/112|d.58.4.3| HM:SCP:REP 1->93|1sqeA_|1.4e-16|32.6|92/0|d.58.4.5|1/1|Dimeric alpha+beta barrel| OP:NHOMO 49 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- ------11222---11111-1-111111111-11111111-2111-111------11---11--1111-11---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 99.0 SQ:SECSTR ccEEEEEEEEccTTTHHHHHHHHHHHHHHHTTcTTEEEEEEEEcTTcTTEEEEEEEEccHHHHHHHHHHcHHHHHHHHHHHTcTTGGGGEEEEEEE# DISOP:02AL 69-84| PSIPRED ccEEEEEEEEEccccHHHHHHHHHHHHHcHHHcccEEEEEEEcccccccEEEEEEEEccHHHHHHHHHHHHHHHHccccccccccccccEEEEEccc //