[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55596.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:56 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   12->42 PF11248 * DUF3046 0.00064 25.8 31/63  

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55596.1 GT:GENE BAF55596.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2852105..2852275) GB:FROM 2852105 GB:TO 2852275 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55596.1 LENGTH 56 SQ:AASEQ MQDPELPVDKVGASTFKTQRLKRWGNCTVDCDIEDGVAEADIFSLESISGVVEFLP GT:EXON 1|1-56:0| HM:PFM:NREP 1 HM:PFM:REP 12->42|PF11248|0.00064|25.8|31/63|DUF3046| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ----------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4| PSIPRED cccccccHHHHcHHHHHHHHHHHHcccEEEEEccccccHHccccHHHHHHHHHHcc //