[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55601.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  14/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:258 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->115 2futA PDBj 7e-04 32.9 %
:HMM:PFM   139->235 PF04480 * DUF559 1.8e-07 20.9 91/109  
:HMM:PFM   69->101 PF03459 * TOBE 0.00041 25.0 32/64  
:BLT:SWISS 10->154 Y2248_MYCTU 6e-04 30.5 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55601.1 GT:GENE BAF55601.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2859133..2859909) GB:FROM 2859133 GB:TO 2859909 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55601.1 LENGTH 258 SQ:AASEQ MAVGMTVDKAVVAGQAAARLWGYQTLGVEKTVLCLLPGRSRAGSIKQQPLGTRYRNSYLSPRDIREVHGIRVTGAFRTFLDIALDDGVVAAVVTIDSARRLNPSLTREKLMHSAEGFPRHRGVKAYRQAIELSIPNSDSAQETRARLILREANLSEIQSVQVQARFDQSHNKHFLVDFLINEWIIVEIDGRSKYNSPELNEVLMAERDREKFFLNQGYAVLRIDPKQLDLDQNGECEFIGILKNTLQKTPPEHLKQAA GT:EXON 1|1-258:0| BL:SWS:NREP 1 BL:SWS:REP 10->154|Y2248_MYCTU|6e-04|30.5|131/271| BL:PDB:NREP 1 BL:PDB:REP 36->115|2futA|7e-04|32.9|79/723| HM:PFM:NREP 2 HM:PFM:REP 139->235|PF04480|1.8e-07|20.9|91/109|DUF559| HM:PFM:REP 69->101|PF03459|0.00041|25.0|32/64|TOBE| OP:NHOMO 16 OP:NHOMOORG 14 OP:PATTERN -------------------------------------------------------------------- -----211111----11---------------1---------------1---112--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 79 STR:RPRED 30.6 SQ:SECSTR ###################################HHTTccccEEEEEEEEcccccEEEEE#EcGGGccTTEEEEEEEEEEEEcccccccEEEEEEEEEEccTTcEEEEEEEEcc############################################################################################################################################### DISOP:02AL 1-4,252-259| PSIPRED ccccccccHHHHHHHHHHHHHccccccccccEEEEEcccccccccccccccEEEEEcccccccEEEEccEEccHHHHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccccccccEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEHHHHccccccHHHHHHHHHHHHccccHHHHHHcc //