[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55606.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  9/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   44->147 PF11377 * DUF3180 3e-04 30.1 %
:HMM:PFM   9->147 PF11377 * DUF3180 5e-44 38.5 135/138  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55606.1 GT:GENE BAF55606.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2864434..2864901) GB:FROM 2864434 GB:TO 2864901 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55606.1 LENGTH 155 SQ:AASEQ MQKTSAGWLIATGGFLAAVSAILTWRFYGSMTSISITVSITFWLLAVVCGFAGVKVQGRLDEGLIGQDKSQMNPVTIAYLAMLGRACAWGGAIFGGVYVGIGSYVIPRAGELSAASNDLPGVIACALGGIALSAAGLYLERSCEAPPPQSGEAIS GT:EXON 1|1-155:0| TM:NTM 4 TM:REGION 4->26| TM:REGION 33->55| TM:REGION 78->100| TM:REGION 118->140| SEG 32->41|tsisitvsit| SEG 95->106|ggvyvgigsyvi| SEG 124->137|acalggialsaagl| RP:PFM:NREP 1 RP:PFM:REP 44->147|PF11377|3e-04|30.1|103/141|DUF3180| HM:PFM:NREP 1 HM:PFM:REP 9->147|PF11377|5e-44|38.5|135/138|DUF3180| OP:NHOMO 9 OP:NHOMOORG 9 OP:PATTERN -------------------------------------------------------------------- -----111111111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4,146-156| PSIPRED ccccccccEEEccHHHHHHHHHHHHEEEcccEEEEEEEHHHHHHHHHHHHccccEEEEEEHHHcccccHHHccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccc //