[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55610.1
DDBJ      :             hypothetical protein
Swiss-Prot:GCH1_CORGB   RecName: Full=GTP cyclohydrolase 1;         EC=3.5.4.16;AltName: Full=GTP cyclohydrolase I;         Short=GTP-CH-I;

Homologs  Archaea  22/68 : Bacteria  714/915 : Eukaryota  186/199 : Viruses  2/175   --->[See Alignment]
d.96.1
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   9->194 1is7A PDBj 1e-44 48.9 %
:RPS:PDB   2->196 1a9cA PDBj 4e-55 36.8 %
:RPS:SCOP  2->196 1a8rA  d.96.1.1 * 2e-65 37.3 %
:HMM:SCOP  8->195 1fb1A_ d.96.1.1 * 1.6e-76 65.1 %
:RPS:PFM   90->177 PF01227 * GTP_cyclohydroI 5e-29 69.8 %
:HMM:PFM   90->177 PF01227 * GTP_cyclohydroI 5.1e-39 69.8 86/86  
:BLT:SWISS 1->196 GCH1_CORGB e-109 100.0 %
:PROS 71->87|PS00859|GTP_CYCLOHYDROL_1_1
:PROS 121->131|PS00860|GTP_CYCLOHYDROL_1_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55610.1 GT:GENE BAF55610.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION complement(2866636..2867226) GB:FROM 2866636 GB:TO 2867226 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55610.1 LENGTH 196 SQ:AASEQ MDNHAAVREFDEERATAAIRELLIAVGEDPDREGLLETPARVARAYKETFAGLHEDPTTVLEKTFSEGHEELVLVREIPIYSMCEHHLVPFFGVAHIGYIPGKSGKVTGLSKLARLADMLAKRPQVQERLTSQIADALVEKLDAQAVAVVIEAEHLCMAMRGIRKPGAVTTTSAVRGGFKNNAASRAEVFSLIRGH GT:EXON 1|1-196:0| SW:ID GCH1_CORGB SW:DE RecName: Full=GTP cyclohydrolase 1; EC=3.5.4.16;AltName: Full=GTP cyclohydrolase I; Short=GTP-CH-I; SW:GN Name=folE; OrderedLocusNames=cgR_2596; SW:KW Complete proteome; GTP-binding; Hydrolase; Metal-binding;Nucleotide-binding; One-carbon metabolism; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->196|GCH1_CORGB|e-109|100.0|196/196| GO:SWS:NREP 5 GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| PROS 71->87|PS00859|GTP_CYCLOHYDROL_1_1|PDOC00672| PROS 121->131|PS00860|GTP_CYCLOHYDROL_1_2|PDOC00672| BL:PDB:NREP 1 BL:PDB:REP 9->194|1is7A|1e-44|48.9|184/194| RP:PDB:NREP 1 RP:PDB:REP 2->196|1a9cA|4e-55|36.8|193/221| RP:PFM:NREP 1 RP:PFM:REP 90->177|PF01227|5e-29|69.8|86/86|GTP_cyclohydroI| HM:PFM:NREP 1 HM:PFM:REP 90->177|PF01227|5.1e-39|69.8|86/86|GTP_cyclohydroI| RP:SCP:NREP 1 RP:SCP:REP 2->196|1a8rA|2e-65|37.3|193/221|d.96.1.1| HM:SCP:REP 8->195|1fb1A_|1.6e-76|65.1|186/196|d.96.1.1|1/1|Tetrahydrobiopterin biosynthesis enzymes-like| OP:NHOMO 1097 OP:NHOMOORG 924 OP:PATTERN ---1-11111111111-111111-1--1--------------------------------------11 1111211111111111111-1111211111121111213322211111111111111111113111211111---111111211111111111111---11122413111--------------1111111111111111111111322122211111111112111221211211111111111111--12111111111111111111111111111111---11111111--------------------1--1--11-1-1111--1--1--111111111111111111111111111111111111111111-1111-1-111111111-1-111111111-1-111-11221111--11111--11111211311111121221121111211111111111111111311111111111112111111111----------11111111111112121121111111--1111111111111----1131111----1111212323322113333-11211111-1--1111111111111112---2----------111-1-----------------------111111--1111111111111111111111111--1111113-11-11111121111111121111--11-11-----11111111111111111-1111111111111111111111111211111111111111111111111111111111111111111111111111111-11111111111111-11111111111111122222322221222222111111111-1111111111121111111111111111----111111-----------------------------------------------1- 11--11--1---111221112112122111111111211111111-2111121211221111111111111111111-1111111111-11121111111111111-1113143411111111111131494-312111111111111111111111222211111-321511211111F1111121221211121111 -------------------1-----------------------------------------------------------------------------------------------------1----------------------------------------------------- STR:NPRED 195 STR:RPRED 99.5 SQ:SECSTR #ccccccHHHHHHHHHHHHHHHHHHTTccTTcTTGGGHHHHHHHHHHHTTGGGcGGGcccccEEcTTcccccEEEEEEEEEEEETTTccEEEEEEEEEEccccEcEEEcHHHHHHHHHHHHccEEcHHHHHHHHHHHHHHHHTcccEEEEEEEEEHHHHccTTccccccEEEEEEcTHHHHcHHHHHHHHHHcccc DISOP:02AL 1-11,196-197| PSIPRED cccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHcccccccccEEEEEccEEEEEEcccccccEEEEEEEEEEEcccccEEEHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEEEEEEccccEEEEEEEEEHHHccHHHHHHHHHHHHcc //