[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Corynebacterium glutamicum R (cglu2)
Gene : BAF55615.1
DDBJ      :             hypothetical protein
Swiss-Prot:IPYR_COREF   RecName: Full=Inorganic pyrophosphatase;         EC=3.6.1.1;AltName: Full=Pyrophosphate phospho-hydrolase;         Short=PPase;

Homologs  Archaea  46/68 : Bacteria  619/915 : Eukaryota  16/199 : Viruses  0/175   --->[See Alignment]
b.40.5
:158 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->158 1wcfA PDBj 2e-59 64.6 %
:RPS:PDB   3->158 2bqyA PDBj 6e-51 42.3 %
:RPS:SCOP  3->157 1fajA  b.40.5.1 * 2e-46 44.1 %
:HMM:SCOP  3->158 8prkA_ b.40.5.1 * 1.2e-59 50.0 %
:RPS:PFM   5->158 PF00719 * Pyrophosphatase 2e-37 55.8 %
:HMM:PFM   5->157 PF00719 * Pyrophosphatase 8.7e-58 51.6 153/156  
:BLT:SWISS 1->158 IPYR_COREF 7e-87 92.4 %
:PROS 52->58|PS00387|PPASE

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID BAF55615.1 GT:GENE BAF55615.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00498CH01 GT:ORG cglu2 GB:ACCESSION GIB00498CH01 GB:LOCATION 2872979..2873455 GB:FROM 2872979 GB:TO 2873455 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAF55615.1 LENGTH 158 SQ:AASEQ MSIEVTVEIPKGSRNKYEIDHETGKVYLDRYLFTPMAYPLDYGYIDHTLGEDGDPLDALVILPESVFPAVVVKSRIIGVFKMTDEAGGDDKLLSVLDDPRYDHIQDISDVSDFLKDEIEHFFVHYKDLEKGKHVDGSGWGDKAEAEKIHAEALERYKA GT:EXON 1|1-158:0| SW:ID IPYR_COREF SW:DE RecName: Full=Inorganic pyrophosphatase; EC=3.6.1.1;AltName: Full=Pyrophosphate phospho-hydrolase; Short=PPase; SW:GN Name=ppa; OrderedLocusNames=CE2546; SW:KW Complete proteome; Cytoplasm; Hydrolase; Magnesium; Metal-binding. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->158|IPYR_COREF|7e-87|92.4|158/158| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 52->58|PS00387|PPASE|PDOC00325| BL:PDB:NREP 1 BL:PDB:REP 1->158|1wcfA|2e-59|64.6|158/162| RP:PDB:NREP 1 RP:PDB:REP 3->158|2bqyA|6e-51|42.3|156/170| RP:PFM:NREP 1 RP:PFM:REP 5->158|PF00719|2e-37|55.8|154/156|Pyrophosphatase| HM:PFM:NREP 1 HM:PFM:REP 5->157|PF00719|8.7e-58|51.6|153/156|Pyrophosphatase| GO:PFM:NREP 4 GO:PFM GO:0000287|"GO:magnesium ion binding"|PF00719|IPR008162| GO:PFM GO:0004427|"GO:inorganic diphosphatase activity"|PF00719|IPR008162| GO:PFM GO:0005737|"GO:cytoplasm"|PF00719|IPR008162| GO:PFM GO:0006796|"GO:phosphate metabolic process"|PF00719|IPR008162| RP:SCP:NREP 1 RP:SCP:REP 3->157|1fajA|2e-46|44.1|152/168|b.40.5.1| HM:SCP:REP 3->158|8prkA_|1.2e-59|50.0|156/0|b.40.5.1|1/1|Inorganic pyrophosphatase| OP:NHOMO 756 OP:NHOMOORG 681 OP:PATTERN 111111111111111111----1-11111111111---------------12111111111111-1-1 1131211111111111111-11111111111111111111111111111111-1111122111111111111111111----111111-----------1-11111211211111111111111-11111211111111111111-1111111111122222211111111222222222222---11----1-----------------1-------111----------------------------------------------------------------------------------------------------------------------------------1---1-----------------1--111111111112111111111111111111112-21111211121111111111111111111----------111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111--11111-------1---------------222211---1111111111111111112-111-11111111-11--1------------------1-1111111111111111211111111111-11111111111111111112221211111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111121111112121111111111---11111111-1122111111111111111---1111----------111111-1111111111111111111-1--------1-- -------------------------------------------------------------------------------------------------------1-1---2---------------------------------------------------------------11-11-----114695-53--1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 158 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEcTTccEEEEEETTTTEEEEEEEcccccccccEEEEccccccTTccccEEEEcccccccTTcEEEEEEEEEEEEEETTEEEEEEEEETTccTTTTcccGGGccHHHHHHHHHHHHHTTTTcTTccEEEEEEEcHHHHHHHHHHHHHHHHc PSIPRED cEEEEEEEEccccccEEEEEcccccEEEEEEcccccccccccccccccccccccEEEEEEEcccccccEEEEEEEEEEEEEEEEccccccEEEEEEccHHHcccccHHHHcHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHHHcc //